Record in detail


General Info

  • lamp_id:L01A003708
  • Name:DB110_HUMAN
  • FullName:Beta-defensin 110
  • Source:Homo sapiens
  • Mass:5654.5 Da
  • Sequence Length:48 aa
  • Isoelectric Point:8.61
  • Activity:Antibacterial
  • Sequence
        KKKYPEYGSLDLRRECRIGNGQCKNQCHENEIRIAYCIRPGTHCCLQQ
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05A0DEF12    From 20 To 67 E-value: 2e-24 Score: 102
        KKKYPEYGSLDLRRECRIGNGQCKNQCHENEIRIAYCIRPGTHCCLQQ
  • 2. L01A003708    From 1 To 48 E-value: 1e-23 Score: 100
        KKKYPEYGSLDLRRECRIGNGQCKNQCHENEIRIAYCIRPGTHCCLQQ
  • 3. L12A05131|    From 1 To 48 E-value: 6e-23 Score: 97.8
        KKKYPEYGSLDLRRECRMGNGRCKNQCHENEIRIAYCIRPGTHCCLQQ
  • 4. L01A003707    From 1 To 48 E-value: 2e-22 Score: 96.3
        KMKYPEYGSLDLRRECRMGNGRCKNQCHENEIRIAYCIRPGTHCCLQQ
  • 5. L12A05129|    From 1 To 48 E-value: 2e-22 Score: 95.5
        KKKYPEYGSLDLRRECREGNGRCKNQCHENEIRIAYCIRPGTHCCLQQ

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ashurst J.L.,Edwards C.A.,Sims S.K.,Palmer S.A.,Mungall A.J.,
  •   Title:The DNA sequence and analysis of human chromosome 6.
  •   Journal:Nature, 2003, 425, 805-811  [MEDLINE:22935763]
  •   [2]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: