Record in detail
General Info
- lamp_id:L01A003709
- Name:DB110_HUMAN
- FullName:Beta-defensin 110
- Source:Homo sapiens
- Mass:5081.8 Da
- Sequence Length:41 aa
- Isoelectric Point:7.73
- Activity:Antibacterial
- Sequence
NFEPKYRFERCEKVRGICKTFCDDVEYDYGYCIKWRSQCCV - Function:Has antibacterial activity (By similarity).
Cross-Linking
- Cross-linking
- 1 Database:Uniprot Q30KR0
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L05A0DEF11 From 22 To 62 E-value: 6e-20 Score: 87.8
NFEPKYRFERCEKVRGICKTFCDDVEYDYGYCIKWRSQCCV - 2. L01A003709 From 1 To 41 E-value: 2e-19 Score: 85.9
NFEPKYRFERCEKVRGICKTFCDDVEYDYGYCIKWRSQCCV - 3. L12A10606| From 4 To 43 E-value: 1e-18 Score: 83.6
FEPKYRFERCEKVRGICKTFCDDVEYDYGYCIKWRSQCCV - 4. L12A10957| From 6 To 44 E-value: 2e-17 Score: 79.7
QPKYRFERCERVRGICKTFCDDVEYDYGYCIKWRSQCCV - 5. L01A003686 From 1 To 41 E-value: 7e-17 Score: 77.8
NFDPKYRFERCAKVKGICKTFCDDDEYDYGYCIKWRNQCCI
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Ashurst J.L.,Edwards C.A.,Sims S.K.,Palmer S.A.,Mungall A.J.,
- Title:The DNA sequence and analysis of human chromosome 6.
- Journal:Nature, 2003, 425, 805-811 [MEDLINE:22935763]
- [2] Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
- Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
- Journal:Physiol. Genomics, 2005, 23, 5-17 [PubMed:16033865]
Comments
- Comments
No comments found on LAMP database