Record in detail
General Info
- lamp_id:L01A003717
- Name:DIP_SARPE
- FullName:Diptericin
- Source:Sarcophaga peregrina
- Mass:3928.3 Da
- Sequence Length:37 aa
- Isoelectric Point:7.54
- Activity:Antibacterial
- Sequence
DLHIPPPDNKINWPQLSGGGGGSPKTGYDININAQQK - Function:Acute phase protein with antibacterial activity against the Gram-negative bacteria E.coli (MIC=6.25 ug/ml) and S.sonnei (MIC=12.5 ug/ml). Lacks antibacterial activity against the Gram-negative bacteria P.vulgaris, P.rettgeri and P.aeruginosa, and against the Gram-positive bacteria B.subtilis, S.aureus, M.luteus, B.megaterium, C.bovis and E.cloacae.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ1127
- 2 Database:DBAASP 2141
- 3 Database:dbAMP dbAMP_01127
- 4 Database:DRAMP DRAMP03069
- 5 Database:SATPdb satpdb11217
- 6 Database:Uniprot Q9TWW2
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A003717 From 1 To 37 E-value: 2e-16 Score: 76.3
DLHIPPPDNKINWPQLSGGGGGSPKTGYDININAQQK - 2. L13A010017 From 15 To 40 E-value: 5.8 Score: 21.6
NLPQLVGGGGGNRKDGFGVSVDAHQK - 3. L01A002945 From 15 To 40 E-value: 8.5 Score: 20.8
NLPQLVGGGGGNRKDGFGVSVDAHQK - 4. L01A002944 From 15 To 40 E-value: 9 Score: 20.8
NLPQLVGGGGGNRKDGFGVSVDAHQK - 5. L12A01023| From 15 To 40 E-value: 9.5 Score: 20.8
NLPQLVGGGGGNRKDGFGVSVDAHQK
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: E.coli MIC: 6.25 μg/ml (1.59102 μM)
- 2 Target: S.sonnei MIC: 12.5 μg/ml (3.18204 μM)
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Natori S.,Kubo T.,Ishikawa M.,
- Title:Purification and characterization of a diptericin homologue from Sarcophaga peregrina (flesh fly).
- Journal:Biochem. J., 1992, 287, 573-578 [MEDLINE:93074996]
Comments
- Comments
No comments found on LAMP database