Record in detail


General Info

  • lamp_id:L01A003717
  • Name:DIP_SARPE
  • FullName:Diptericin
  • Source:Sarcophaga peregrina
  • Mass:3928.3 Da
  • Sequence Length:37 aa
  • Isoelectric Point:7.54
  • Activity:Antibacterial
  • Sequence
        DLHIPPPDNKINWPQLSGGGGGSPKTGYDININAQQK
  • Function:Acute phase protein with antibacterial activity against the Gram-negative bacteria E.coli (MIC=6.25 ug/ml) and S.sonnei (MIC=12.5 ug/ml). Lacks antibacterial activity against the Gram-negative bacteria P.vulgaris, P.rettgeri and P.aeruginosa, and against the Gram-positive bacteria B.subtilis, S.aureus, M.luteus, B.megaterium, C.bovis and E.cloacae.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003717    From 1 To 37 E-value: 2e-16 Score: 76.3
        DLHIPPPDNKINWPQLSGGGGGSPKTGYDININAQQK
  • 2. L13A010017    From 15 To 40 E-value: 5.8 Score: 21.6
        NLPQLVGGGGGNRKDGFGVSVDAHQK
  • 3. L01A002945    From 15 To 40 E-value: 8.5 Score: 20.8
        NLPQLVGGGGGNRKDGFGVSVDAHQK
  • 4. L01A002944    From 15 To 40 E-value: 9 Score: 20.8
        NLPQLVGGGGGNRKDGFGVSVDAHQK
  • 5. L12A01023|    From 15 To 40 E-value: 9.5 Score: 20.8
        NLPQLVGGGGGNRKDGFGVSVDAHQK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E.coli  MIC:  6.25 μg/ml  (1.59102 μM)  
  •   2  Target:  S.sonnei  MIC:  12.5 μg/ml  (3.18204 μM)  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Natori S.,Kubo T.,Ishikawa M.,
  •   Title:Purification and characterization of a diptericin homologue from Sarcophaga peregrina (flesh fly).
  •   Journal:Biochem. J., 1992, 287, 573-578  [MEDLINE:93074996]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: