Record in detail


General Info

  • lamp_id:L01A003724
  • Name:DB132_HUMAN
  • FullName:Beta-defensin 132
  • Source:Homo sapiens
  • Mass:8311.5 Da
  • Sequence Length:73 aa
  • Isoelectric Point:9.86
  • Activity:Antibacterial
  • Sequence
        GGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS
  • Function:Has antibacterial activity (Potential).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05A0DEF32    From 23 To 95 E-value: 7.00005e-41 Score: 157
        GGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS
  • 2. L01A003724    From 1 To 73 E-value: 5e-40 Score: 154
        GGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS
  • 3. L12A02757|    From 1 To 73 E-value: 2e-38 Score: 149
        GGSKCVSNTPGYCRTYCHWGETALFMCNASRKCCVSYSFLPKPDLPRLIGNHWQSRRRNTQRKDKKQQTTVTS
  • 4. L01A003654    From 1 To 73 E-value: 6e-38 Score: 147
        GGSKCVSNTPGYCRTYCHQGETALFMCNASRKCCVSYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS
  • 5. L01A003655    From 1 To 73 E-value: 9e-38 Score: 147
        GGSKCVSNTPGYCRTYCHWGETALFMCNASRKCCVSYSFLPKADLPRLIGNHWQSRRRNTQRKDKKQQTTVTS

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Gilbert J.G.R.,Burton J.,Ashurst J.L.,Matthews L.H.,Deloukas P.,
  •   Title:The DNA sequence and comparative analysis of human chromosome 20.
  •   Journal:Nature, 2001, 414, 865-871  [MEDLINE:21638749]
  •   [2]  Conejo-Garcia J.-R.,Forssmann W.-G.,Schulz S.,Krause A.,Rodriguez-Jimenez F.-J.,
  •   Title:Distribution of new human beta-defensin genes clustered on chromosome 20 in functionally different segments of epididymis.
  •   Journal:Genomics, 2003, 81, 175-183  [PubMed:12620395]
  •   [3]  Baldwin D.T.,Baker K.,Abaya E.,Gurney A.L.,Clark H.F.,
  •   Title:The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
  •   Journal:Genome Res., 2003, 13, 2265-2270  [MEDLINE:22887296]
  •   [4]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]
  •   [5]  Zhang J.S.,Liu Q.,Liu J.,Wang H.Y.,Li J.Y.,
  •   Title:Transcriptome analysis of a cDNA library from adult human epididymis.
  •   Journal:DNA Res., 2008, 15, 115-122  [PubMed:18390568]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: