Record in detail


General Info

  • lamp_id:L01A003728
  • Name:DEF16_ARATH
  • FullName:Defensin-like protein 16
  • Source:Arabidopsis thaliana
  • Mass:5492.3 Da
  • Sequence Length:51 aa
  • Isoelectric Point:8.21
  • Activity:Antifungal
  • Sequence
        QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVPC
  • Function:Confers broad-spectrum resistance to pathogens. Has antifungal activity in vitro.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF273    From 30 To 80 E-value: 1e-26 Score: 110
        QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVPC
  • 2. L05ADEF285    From 30 To 80 E-value: 1e-26 Score: 110
        QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVPC
  • 3. L05ADEF270    From 30 To 80 E-value: 1e-26 Score: 109
        QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVPC
  • 4. L05ADEF279    From 30 To 80 E-value: 4e-26 Score: 108
        QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYFPC
  • 5. L01A003728    From 1 To 51 E-value: 2e-25 Score: 105
        QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVPC

Structure

  •   Domains
  •   1  Name:Gamma-thionin    Interpro Link:IPR008176
  •   2  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  De Samblanx G.W.,Thomma B.P.H.J.,Terras F.R.G.,Eggermont K.,Penninckx I.A.M.A.,
  •   Title:Pathogen-induced systemic activation of a plant defensin gene in Arabidopsis follows a salicylic acid-independent pathway.
  •   Journal:Plant Cell, 1996, 8, 2309-2323  [PubMed:8989885]
  •   [2]  Bohlmann H.,Apel K.,Epple P.,
  •   Title:ESTs reveal a multigene family for plant defensins in Arabidopsis thaliana.
  •   Journal:FEBS Lett., 1997, 400, 168-172  [PubMed:9001391]
  •   [3]  Broekaert W.F.,Metraux J.-P.,Buchala A.,Thomma B.P.H.J.,Penninckx I.A.M.A.,
  •   Title:Concomitant activation of jasmonate and ethylene response pathways is required for induction of a plant defensin gene in Arabidopsis.
  •   Journal:Plant Cell, 1998, 10, 2103-2113  [PubMed:9836748]
  •   [4]  Asamizu E.,Nakamura Y.,Sato S.,Katoh T.,Kaneko T.,
  •   Title:Structural analysis of Arabidopsis thaliana chromosome 5. IX. Sequence features of the regions of 1,011,550 bp covered by seventeen P1 and TAC clones.
  •   Journal:DNA Res., 1999, 6, 183-195  [MEDLINE:99397451]
  •   [5]  Cock J.M.,Dumas C.,Miege C.,Vanoosthuyse V.,
  •   Title:Two large Arabidopsis thaliana gene families are homologous to the Brassica gene superfamily that encodes pollen coat proteins and the male component of the self-incompatibility response.
  •   Journal:Plant Mol. Biol., 2001, 46, 17-34  [MEDLINE:21330246]
  •   [6]  Thevissen K.,Cammue B.P.,Thomma B.P.H.J.,
  •   Title:Plant defensins.
  •   Journal:Planta, 2002, 216, 193-202  [PubMed:12447532]
  •   [7]  Shinn P.,Chen H.,Dale J.M.,Lim J.,Yamada K.,
  •   Title:Empirical analysis of transcriptional activity in the Arabidopsis genome.
  •   Journal:Science, 2003, 302, 842-846  [MEDLINE:22954850]
  •   [8]  VandenBosch K.A.,Paape T.D.,Graham M.A.,Silverstein K.A.T.,
  •   Title:Genome organization of more than 300 defensin-like genes in Arabidopsis.
  •   Journal:Plant Physiol., 2005, 138, 600-610  [PubMed:15955924]
  •   [9]  Pieterse C.M.J.,De Vos M.,Champion A.,Atallah M.,Pre M.,
  •   Title:The AP2/ERF domain transcription factor ORA59 integrates jasmonic acid and ethylene signals in plant defense.
  •   Journal:Plant Physiol., 2008, 147, 1347-1357  [PubMed:18467450]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: