Record in detail


General Info

  • lamp_id:L01A003736
  • Name:OXLA_NAJKA
  • FullName:L-amino-acid oxidase
  • Source:Naja kaouthia
  • Mass:4405.8 Da
  • Sequence Length:38 aa
  • Isoelectric Point:4.89
  • Activity:Antibacterial
  • Sequence
        DDRRSPLEECFQQNDYEEFLEIAKNGLKKTXNPKHVXV
  • Function:Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids (highly active against L-Phe and L-Tyr, and moderately active against L-Trp, L-Met, L-Leu, and L-Arg), thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, apoptosis of vascular endothelial cells or tumor cell lines, antibacterial and antiparasitic activities (By similarity). This protein inhibits both agonist- and shear stress-induced platelet aggregation (SIPA). Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003736    From 1 To 38 E-value: 1e-16 Score: 76.6
        DDRRSPLEECFQQNDYEEFLEIAKNGLKKTXNPKHVXV
  • 2. L01A003738    From 2 To 38 E-value: 0.00000000001 Score: 60.1
        DDRNPLEQCFRETDYEEFLEIARNNLKATSNPKHVVI
  • 3. L13A010532    From 2 To 38 E-value: 0.00000000002 Score: 59.7
        DDRNPLEQCFRETDYEEFLEIARNNLKATSNPKHVVI
  • 4. L01A003739    From 2 To 37 E-value: 0.00000006 Score: 48.1
        DDKNPLEE-FRETNYEVFLEIAKNGLKATSNPKRVVI
  • 5. L01A003737    From 2 To 27 E-value: 0.00001 Score: 40.4
        DDKNPLEEAFREADYEVFLEIAKNGL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Swaminathan S.,Tan N.-H.,
  •   Title:Purification and properties of the L-amino acid oxidase from monocellate cobra (Naja naja kaouthia) venom.
  •   Journal:Int. J. Biochem., 1992, 24, 967-973  [PubMed:1612186]
  •   [2]  Suzuki M.,Matsui T.,Yoshioka A.,Takatsuka H.,Sakurai Y.,
  •   Title:Inhibition of human platelet aggregation by L-amino acid oxidase purified from Naja naja kaouthia venom.
  •   Journal:Toxicon, 2001, 39, 1827-1833  [PubMed:11600144]
  •   [3]  Siigur J.,Vija H.,Ronnholm G.,Tonismagi K.,Samel M.,
  •   Title:L-Amino acid oxidase from Naja naja oxiana venom.
  •   Journal:Comp. Biochem. Physiol., 2008, 149, 572-580  [PubMed:18294891]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: