Record in detail
General Info
- lamp_id:L01A003736
- Name:OXLA_NAJKA
- FullName:L-amino-acid oxidase
- Source:Naja kaouthia
- Mass:4405.8 Da
- Sequence Length:38 aa
- Isoelectric Point:4.89
- Activity:Antibacterial
- Sequence
DDRRSPLEECFQQNDYEEFLEIAKNGLKKTXNPKHVXV - Function:Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids (highly active against L-Phe and L-Tyr, and moderately active against L-Trp, L-Met, L-Leu, and L-Arg), thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, apoptosis of vascular endothelial cells or tumor cell lines, antibacterial and antiparasitic activities (By similarity). This protein inhibits both agonist- and shear stress-induced platelet aggregation (SIPA). Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions.
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ2121
- 2 Database:dbAMP dbAMP_01011
- 3 Database:DRAMP DRAMP03168
- 4 Database:Uniprot P0C2D4
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A003736 From 1 To 38 E-value: 1e-16 Score: 76.6
DDRRSPLEECFQQNDYEEFLEIAKNGLKKTXNPKHVXV - 2. L01A003738 From 2 To 38 E-value: 0.00000000001 Score: 60.1
DDRNPLEQCFRETDYEEFLEIARNNLKATSNPKHVVI - 3. L13A010532 From 2 To 38 E-value: 0.00000000002 Score: 59.7
DDRNPLEQCFRETDYEEFLEIARNNLKATSNPKHVVI - 4. L01A003739 From 2 To 37 E-value: 0.00000006 Score: 48.1
DDKNPLEE-FRETNYEVFLEIAKNGLKATSNPKRVVI - 5. L01A003737 From 2 To 27 E-value: 0.00001 Score: 40.4
DDKNPLEEAFREADYEVFLEIAKNGL
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Swaminathan S.,Tan N.-H.,
- Title:Purification and properties of the L-amino acid oxidase from monocellate cobra (Naja naja kaouthia) venom.
- Journal:Int. J. Biochem., 1992, 24, 967-973 [PubMed:1612186]
- [2] Suzuki M.,Matsui T.,Yoshioka A.,Takatsuka H.,Sakurai Y.,
- Title:Inhibition of human platelet aggregation by L-amino acid oxidase purified from Naja naja kaouthia venom.
- Journal:Toxicon, 2001, 39, 1827-1833 [PubMed:11600144]
- [3] Siigur J.,Vija H.,Ronnholm G.,Tonismagi K.,Samel M.,
- Title:L-Amino acid oxidase from Naja naja oxiana venom.
- Journal:Comp. Biochem. Physiol., 2008, 149, 572-580 [PubMed:18294891]
Comments
- Comments
No comments found on LAMP database