Record in detail


General Info

  • lamp_id:L01A003738
  • Name:OXLA_CRODC
  • FullName:L-amino-acid oxidase
  • Source:Crotalus durissus cascavella
  • Mass:6561.3 Da
  • Sequence Length:61 aa
  • Isoelectric Point:4.88
  • Activity:Antibacterial, Antiparasitic
  • Sequence
        ADDRNPLEQCFRETDYEEFLEIARNNLKATSNPKHVVIVGAGMAGLSAAYVLSGGGHQVTV
  • Function:Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as apoptosis, antibacterial activities against both Gram-negative and Gram-positive bacteria and antiparasitic activities, as well as induction of platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions. This protein may also induce hemorrhage, hemolysis, and edema.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003738    From 1 To 61 E-value: 2e-32 Score: 129
        ADDRNPLEQCFRETDYEEFLEIARNNLKATSNPKHVVIVGAGMAGLSAAYVLSGGGHQVTV
  • 2. L13A010532    From 1 To 50 E-value: 9e-26 Score: 107
        ADDRNPLEQCFRETDYEEFLEIARNNLKATSNPKHVVIVGAGMAGLSAAY
  • 3. L01A003739    From 1 To 49 E-value: 4e-19 Score: 85.1
        ADDKNPLEE-FRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY
  • 4. L01A003736    From 2 To 38 E-value: 0.00000000001 Score: 60.1
        DRRSPLEECFQQNDYEEFLEIAKNGLKKTXNPKHVXV
  • 5. L01A003734    From 1 To 24 E-value: 0.00000005 Score: 48.5
        ADNKNPLEECFRETNYEEFLEIAR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Corbett C.E.,Laurenti M.D.,Passero L.F.,Toyama Dde O.,Toyama M.H.,
  •   Title:Isolation of a new L-amino acid oxidase from Crotalus durissus cascavella venom.
  •   Journal:Toxicon, 2006, 47, 47-57  [PubMed:16307769]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: