Record in detail


General Info

  • lamp_id:L01A003739
  • Name:OXLA_BOTPI
  • FullName:L-amino-acid oxidase
  • Source:Bothrops pirajai
  • Mass:5298.9 Da
  • Sequence Length:49 aa
  • Isoelectric Point:4.86
  • Activity:Antibacterial, ,Anticancer
  • Sequence
        ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY
  • Function:Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as edema, antibacterial (E.coli, and P.aeruginosa) and antiparasitic activities, as well as induction of platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions. This protein may also have activities in hemorrhage, hemolysis, and apoptosis.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003739    From 1 To 49 E-value: 7e-24 Score: 100
        ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY
  • 2. L01A003738    From 1 To 50 E-value: 4e-19 Score: 85.1
        ADDRNPLEQCFRETDYEEFLEIARNNLKATSNPKHVVIVGAGMAGLSAAY
  • 3. L13A010532    From 1 To 50 E-value: 5e-19 Score: 84.7
        ADDRNPLEQCFRETDYEEFLEIARNNLKATSNPKHVVIVGAGMAGLSAAY
  • 4. L01A003736    From 2 To 38 E-value: 0.00000006 Score: 48.1
        DRRSPLEECFQQNDYEEFLEIAKNGLKKTXNPKHVXV
  • 5. L01A003737    From 1 To 27 E-value: 0.00000006 Score: 47.8
        ADDKNPLEEAFREADYEVFLEIAKNGL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Hamaguchi A.,Sant"Ana C.D.,Souza G.R.L.,Ribeiro M.C.,Izidoro L.F.M.,
  •   Title:Biochemical and functional characterization of an L-amino acid oxidase isolated from Bothrops pirajai snake venom.
  •   Journal:Bioorg. Med. Chem., 2006, 14, 7034-7043  [PubMed:16809041]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: