Record in detail


General Info

  • lamp_id:L01A003741
  • Name:OXLA_BITGA
  • FullName:L-amino-acid oxidase
  • Source:Bitis gabonica
  • Mass:7322.6 Da
  • Sequence Length:60 aa
  • Isoelectric Point:10.51
  • Activity:Antibacterial
  • Sequence
        GPMRIPEKHRIVREYIRKFGLQLNEFVQETENAWYYIKNIRKKVHEVKKDPGLLKYPVKP
  • Function:Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, apoptosis of vascular endothelial cells or tumor cell lines, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Effects of snake L-amino oxidases on platelets are controversial, since they either induce aggregation or inhibit agonist-induced aggregation. These different effects are probably due to different experimental conditions (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003741    From 1 To 60 E-value: 2e-30 Score: 122
        GPMRIPEKHRIVREYIRKFGLQLNEFVQETENAWYYIKNIRKKVHEVKKDPGLLKYPVKP
  • 2. L01A000174    From 1 To 22 E-value: 9.3 Score: 20.8
        ETESTPDYLKNIQQQLEEYTKN
  • 3. L13A013420    From 1 To 22 E-value: 9.6 Score: 20.8
        ETESTPDYLKNIQQQLEEYTKN

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ribeiro J.M.C.,Garfield M.K.,Harrison J.,My-Pham V.,Francischetti I.M.B.,
  •   Title:Bitis gabonica (Gaboon viper) snake venom gland: toward a catalog for the full-length transcripts (cDNA) and proteins.
  •   Journal:Gene, 2004, 337, 55-69  [PubMed:15276202]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: