Record in detail


General Info

  • lamp_id:L01A003754
  • Name:CECB_ANOGA
  • FullName:Cecropin-B
  • Source:Anopheles gambiae
  • Mass:3854.7 Da
  • Sequence Length:34 aa
  • Isoelectric Point:12.16
  • Activity:Antibacterial
  • Sequence
        APRWKFGKRLEKLGRNVFRAAKKALPVIAGYKAL
  • Function:Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003754    From 1 To 34 E-value: 0.00000000000008 Score: 67.4
        APRWKFGKRLEKLGRNVFRAAKKALPVIAGYKAL
  • 2. L12A10212|    From 6 To 39 E-value: 0.0000000000001 Score: 67
        APRWKFGKRLEKLGRNVFRAAKKALPVVAGYKAL
  • 3. L12A08730|    From 28 To 61 E-value: 0.000000000002 Score: 62.8
        APRWKFGKKLEKVGKNVFNAAKKALPVVAGYKAL
  • 4. L01A002591    From 26 To 59 E-value: 0.00000000004 Score: 58.5
        APRMEIGKRREKLGRNVFKAAKKALPVIAGYKAL
  • 5. L11A009759    From 1 To 34 E-value: 0.00000000008 Score: 57.8
        APRMEIGKRREKLGRNVFKAAKKALPVIAGYKAL

Structure

  •   Domains
  •   1  Name:Cecropin    Interpro Link:IPR000875
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zheng A.L.,Zheng X.-L.,
  •   Title:Genomic organization and regulation of three cecropin genes in Anopheles gambiae.
  •   Journal:Insect Mol. Biol., 2002, 11, 517-525  [PubMed:12421409]
  •   [2]  Charlab R.,Sutton G.G.,Halpern A.,Subramanian G.M.,Holt R.A.,
  •   Title:The genome sequence of the malaria mosquito Anopheles gambiae.
  •   Journal:Science, 2002, 298, 129-149  [MEDLINE:22251359]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: