Record in detail


General Info

  • lamp_id:L01A003770
  • Name:GGI1_STAHA
  • FullName:Antibacterial protein 1
  • Source:Staphylococcus haemolyticus
  • Mass:4523.3 Da
  • Sequence Length:44 aa
  • Isoelectric Point:6.62
  • Activity:Antibacterial
  • Sequence
        MQKLAEAIAAAVSAGQDKDWGKMGTSIVGIVENGITVLGKIFGF
  • Function:Has haemolytic activity and also inhibits the growth of gonococci.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003770    From 1 To 44 E-value: 1e-19 Score: 87
        MQKLAEAIAAAVSAGQDKDWGKMGTSIVGIVENGITVLGKIFGF
  • 2. L01A003762    From 1 To 44 E-value: 0.0000000000001 Score: 66.6
        MQKLAEAIAAAVQAGQDKDWGKMGTSIVGIVENGISVLGKIFGF
  • 3. L01A003764    From 1 To 44 E-value: 0.0000000000002 Score: 65.9
        MSKLVQAISDAVQAGQNQDWAKLGTSIVGIVENGVGILGKLFGF
  • 4. L01A003768    From 1 To 44 E-value: 0.000000000001 Score: 63.5
        MSKLVQAISDAVQAQQNQDWAKLGTSIVGIVENGVGILGKLFGF
  • 5. L01A003763    From 1 To 44 E-value: 0.00000000001 Score: 60.5
        MEKIANAVKSAIEAGQNQDWTKLGTSILDIVSNGVTELSKIFGF

Structure

  •   Domains
  •   1  Name:Staph_haemolytic    Interpro Link:IPR008846
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Morosoli R.,Beaudet R.,Bisaillon J.G.,Yaguchi M.,Watson D.C.,
  •   Title:The amino acid sequence of a gonococcal growth inhibitor from Staphylococcus haemolyticus.
  •   Journal:Biochem. J., 1988, 252, 87-93  [MEDLINE:88339821]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: