Record in detail


General Info

  • lamp_id:L01A003775
  • Name:THMYZ_THETS
  • FullName:Theromyzin
  • Source:Theromyzon tessulatum
  • Mass:9979 Da
  • Sequence Length:86 aa
  • Isoelectric Point:6.51
  • Activity:Antibacterial
  • Sequence
        DHHHDHGHDDHEHEELTLEKIKEKIKDYADKTPVDQLTERVQAGRDYLLGKGARPSHLPARVDRHLSKLTAAEKQELADYLLTFLH
  • Function:Has bacteriostatic activity against M.luteus. No activity toward E.coli and F.oxysporum.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003775    From 1 To 86 E-value: 5.60519e-45 Score: 171
        DHHHDHGHDDHEHEELTLEKIKEKIKDYADKTPVDQLTERVQAGRDYLLGKGARPSHLPARVDRHLSKLTAAEKQELADYLLTFLH
  • 2. L12A01046|    From 1 To 80 E-value: 1.99993e-41 Score: 159
        DHHHDHGHDDHEHEELTLEKIKEKIKDYADKTPVDQLTERVQAGRDYLLGKGARPSHLPARVDRHLSKLTAAEKQELADY
  • 3. L13A010185    From 1 To 50 E-value: 1e-23 Score: 100
        DHHHDHGHDDHEHEELTLEKIKEKIKDYADKTPVDQLTERVQAGRDYLLG
  • 4. L12A08829|    From 1 To 42 E-value: 4.2 Score: 21.9
        MNNVKELSIKEMQQVTGGDQMSDGVNYGKGSSLSKGGAKCGL
  • 5. L12A07397|    From 35 To 69 E-value: 6.7 Score: 21.2
        ELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQD

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lefebvre C.,Lemoine J.,Mitta G.,Vandenbulcke F.,Tasiemski A.,
  •   Title:Molecular characterization of two novel antibacterial peptides inducible upon bacterial challenge in an annelid, the leech Theromyzon tessulatum.
  •   Journal:J. Biol. Chem., 2004, 279, 30973-30982  [PubMed:15102860]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: