Record in detail
General Info
- lamp_id:L01A003782
- Name:AMP_IPONI
- FullName:Antimicrobial protein PN-AMP1
- Source:Ipomoea nil
- Mass:4238.7 Da
- Sequence Length:40 aa
- Isoelectric Point:8.41
- Activity:Antifungal
- Sequence
QQCGRQASGRLCGNRLCCSQWGYCGSTASYCGAGCQSQCR - Function:Chitin-binding protein with a defensive function against numerous chitin containing fungal pathogens. It is also an inhibitor of Gram-positive bacteria such as B.subtilis.
Cross-Linking
- Cross-linking
- 1 Database:APD 1052
- 2 Database:CAMP CAMPSQ1139
- 3 Database:dbAMP dbAMP_10223
- 4 Database:DRAMP DRAMP00986
- 5 Database:SATPdb satpdb27742
- 6 Database:Uniprot P81591
- 7 Database:PHY PHYT00234
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A000581 From 1 To 40 E-value: 2e-16 Score: 76.6
QQCGRQASGRLCGNRLCCSQWGYCGSTASYCGAGCQSQCR - 2. L01A003782 From 1 To 40 E-value: 2e-16 Score: 76.3
QQCGRQASGRLCGNRLCCSQWGYCGSTASYCGAGCQSQCR - 3. L11A005517 From 2 To 40 E-value: 5e-16 Score: 74.7
QCGRQASGRLCGNRLCCSQWGYCGSTASYCGAGCQSQCR - 4. L11A005518 From 2 To 40 E-value: 6e-16 Score: 74.7
QCGRQASGRLCGNRLCCSQWGYCGSTASYCGAGCQSQCR - 5. L06AT00231 From 1 To 42 E-value: 0.0000000008 Score: 54.3
EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCK
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Choi J.S.,Cheong Y.H.,Chun H.J.,Lee S.Y.,Koo J.C.,
- Title:Two hevein homologs isolated from the seed of Pharbitis nil L. exhibit potent antifungal activity.
- Journal:Biochim. Biophys. Acta, 1998, 1382, 80-90 [MEDLINE:98173779]
Comments
- Comments
No comments found on LAMP database