Record in detail


General Info

  • lamp_id:L01A003782
  • Name:AMP_IPONI
  • FullName:Antimicrobial protein PN-AMP1
  • Source:Ipomoea nil
  • Mass:4238.7 Da
  • Sequence Length:40 aa
  • Isoelectric Point:8.41
  • Activity:Antifungal
  • Sequence
        QQCGRQASGRLCGNRLCCSQWGYCGSTASYCGAGCQSQCR
  • Function:Chitin-binding protein with a defensive function against numerous chitin containing fungal pathogens. It is also an inhibitor of Gram-positive bacteria such as B.subtilis.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000581    From 1 To 40 E-value: 2e-16 Score: 76.6
        QQCGRQASGRLCGNRLCCSQWGYCGSTASYCGAGCQSQCR
  • 2. L01A003782    From 1 To 40 E-value: 2e-16 Score: 76.3
        QQCGRQASGRLCGNRLCCSQWGYCGSTASYCGAGCQSQCR
  • 3. L11A005517    From 2 To 40 E-value: 5e-16 Score: 74.7
        QCGRQASGRLCGNRLCCSQWGYCGSTASYCGAGCQSQCR
  • 4. L11A005518    From 2 To 40 E-value: 6e-16 Score: 74.7
        QCGRQASGRLCGNRLCCSQWGYCGSTASYCGAGCQSQCR
  • 5. L06AT00231    From 1 To 42 E-value: 0.0000000008 Score: 54.3
        EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCK

Structure

  •   Domains
  •   1  Name:Chitin-bd_1    Interpro Link:IPR001002
  •   2  Name:Chitin-binding_1_CS    Interpro Link:IPR018371
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Choi J.S.,Cheong Y.H.,Chun H.J.,Lee S.Y.,Koo J.C.,
  •   Title:Two hevein homologs isolated from the seed of Pharbitis nil L. exhibit potent antifungal activity.
  •   Journal:Biochim. Biophys. Acta, 1998, 1382, 80-90  [MEDLINE:98173779]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: