Record in detail


General Info

  • lamp_id:L01A003797
  • Name:ELAF_HUMAN
  • FullName:Elafin
  • Source:Homo sapiens
  • Mass:6007.1 Da
  • Sequence Length:57 aa
  • Isoelectric Point:8.21
  • Activity:Antibacterial
  • Sequence
        AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
  • Function:Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis.

Cross-Linking

  •   Cross-linking
  •   1  Database:APD  1580
  •   2  Database:CAMP  CAMPSQ1144
  •   3  Database:DBAASP  5269
  •   4  Database:dbAMP  dbAMP_00487
  •   5  Database:Uniprot  P19957

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003797    From 1 To 57 E-value: 4e-28 Score: 115
        AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
  • 2. L13A019733    From 1 To 50 E-value: 9e-24 Score: 100
        AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCG
  • 3. L01A003584    From 5 To 50 E-value: 0.0000004 Score: 45.4
        TEKPGVCPADNVRCIKSDPP-QCHTDQDCQGIRKCCYLHCGFKCVIP
  • 4. L01A003593    From 6 To 50 E-value: 0.0000004 Score: 45.1
        EKPGVCPADNIRCIKSDPP-QCHTDQDCQGIRKCCYLHCGFKCVIP
  • 5. L01A003594    From 1 To 50 E-value: 0.000001 Score: 43.5
        VKGNIE-KPEVCPADNVRCIKSDPP-QCHTDQDCQGIRKCCYLHCGFKCVIP

Structure

  •   Domains
  •   1  Name:4-disulphide_core    Interpro Link:IPR015874
  •   2  Name:SVP_I    Interpro Link:IPR002098
  •   3  Name:Trappin_transglut-bd_rpt    Interpro Link:IPR019541
  •   4  Name:Whey_acidic_protein_4-diS_core    Interpro Link:IPR008197
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Christophers E.,Young J.A.,Gregory H.,Schroeder J.-M.,Wiedow O.,
  •   Title:
  •   Journal:J. Biol. Chem., 1991, 266, 3356-3356  [:]
  •   [2]  Christophers E.,Young J.A.,Gregory H.,Schroeder J.-M.,Wiedow O.,
  •   Title:Elafin: an elastase-specific inhibitor of human skin. Purification, characterization, and complete amino acid sequence.
  •   Journal:J. Biol. Chem., 1990, 265, 14791-14795  [MEDLINE:90368643]
  •   [3]  Ryle A.P.,Sallenave J.-M.,
  •   Title:Purification and characterization of elastase-specific inhibitor. Sequence homology with mucus proteinase inhibitor.
  •   Journal:Biol. Chem. Hoppe-Seyler, 1991, 372, 13-21  [MEDLINE:91248412]
  •   [4]  de Jongh G.J.,de Roo C.,Schalkwijk J.,
  •   Title:Skin-derived antileukoproteinase (SKALP), an elastase inhibitor from human keratinocytes. Purification and biochemical properties.
  •   Journal:Biochim. Biophys. Acta, 1991, 1096, 148-154  [MEDLINE:91159523]
  •   [5]  Ryle A.P.,Marsden M.D.,Sallenave J.-M.,
  •   Title:Isolation of elafin and elastase-specific inhibitor (ESI) from bronchial secretions. Evidence of sequence homology and immunological cross-reactivity.
  •   Journal:Biol. Chem. Hoppe-Seyler, 1992, 373, 27-33  [MEDLINE:92162196]
  •   [6]  Kuroki J.,Saito Y.,Hagiwara H.,Ito F.,Saheki T.,
  •   Title:Primary structure of the human elafin precursor preproelafin deduced from the nucleotide sequence of its gene and the presence of unique repetitive sequences in the prosegment.
  •   Journal:Biochem. Biophys. Res. Commun., 1992, 185, 240-245  [MEDLINE:92287100]
  •   [7]  Silva A.,Sallenave J.-M.,
  •   Title:Characterization and gene sequence of the precursor of elafin, an elastase-specific inhibitor in bronchial secretions.
  •   Journal:Am. J. Respir. Cell Mol. Biol., 1993, 8, 439-445  [MEDLINE:93236929]
  •   [8]  Wieringa B.,de Jongh G.J.,Zeeuwen P.L.J.M.,Alkemade H.A.C.,Molhuizen H.O.F.,
  •   Title:SKALP/elafin: an elastase inhibitor from cultured human keratinocytes. Purification, cDNA sequence, and evidence for transglutaminase cross-linking.
  •   Journal:J. Biol. Chem., 1993, 268, 12028-12032  [MEDLINE:93280175]
  •   [9]  Katsube Y.,Sakakibara S.,Matsuura Y.,Tsunemi M.,
  •   Title:Crystal structure of an elastase-specific inhibitor elafin complexed with porcine pancreatic elastase determined at 1.9-A resolution.
  •   Journal:Biochemistry, 1996, 35, 11570-11576  [MEDLINE:96387196]
  •   [10]  Lippens G.,Alix A.J.P.,Dauchez M.,Francart C.,
  •   Title:Solution structure of R-elafin, a specific inhibitor of elastase.
  •   Journal:J. Mol. Biol., 1997, 268, 666-677  [MEDLINE:97315116]
  •   [11]  Gilbert J.G.R.,Burton J.,Ashurst J.L.,Matthews L.H.,Deloukas P.,
  •   Title:The DNA sequence and comparative analysis of human chromosome 20.
  •   Journal:Nature, 2001, 414, 865-871  [MEDLINE:21638749]
  •   [12]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: