Record in detail


General Info

  • lamp_id:L01A003802
  • Name:AMP_TRIKH
  • FullName:Antimicrobial peptide 1b
  • Source:Triticum kiharae
  • Mass:4445 Da
  • Sequence Length:44 aa
  • Isoelectric Point:8.08
  • Activity:Antifungal
  • Sequence
        AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGC
  • Function:Binds chitin. WAMP-1a has antifungal activity against the fungi F.solani (IC(50)=5 ug/ml), F.verticillioides (IC(50)=30 ug/ml), F.oxysporum (IC(50)=5 ug/ml), B.sorokiniana (IC(50)=5 ug/ml), B.cinerea (IC(50)=20 ug/ml) and N.crassa (IC(50)=10 ug/ml). Inhibits hyphal elongation and causes browning of hyphae in F.oxysporum. Causes destruction and discoloration of spores in B.sorokiniana. Inhibits the development of disease caused by the fungus P.infestans on potato tubers. Has antibacterial activity against the Gram-negative bacteria P.syringae and E.carotovora, and the Gram-positive bacterium C.michiganensis.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001470    From 1 To 44 E-value: 9e-19 Score: 84
        AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGC
  • 2. L01A003802    From 1 To 44 E-value: 1e-18 Score: 83.6
        AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGC
  • 3. L11A012394    From 1 To 44 E-value: 3e-18 Score: 82.4
        AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGEGSCQSQCRGC
  • 4. L13A014396    From 1 To 43 E-value: 3e-18 Score: 82.4
        QRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGC
  • 5. L11A012393    From 1 To 44 E-value: 3e-18 Score: 82.4
        AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGKGSCQSQCRGC

Structure

  •   Domains
  •   1  Name:Chitin-bd_1    Interpro Link:IPR001002
  •   Structures

Activity

  •   Antibacterial Activities
  •   1  Target:  Bipolaris sorokiniana  IC50:  5 μg/ml  (1.12486 μM)  
  •   2  Target:  Botrytis cinerea  IC50:  20 μg/ml  (4.49944 μM)  
  •   3  Target:  Fusarium oxysporum  IC50:  5 μg/ml  (1.12486 μM)  
  •   4  Target:  Fusarium solani  IC50:  5 μg/ml  (1.12486 μM)  
  •   5  Target:  Fusarium verticillioides  IC50:  30 μg/ml  (6.74916 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Grishin E.V.,Pukhalsky V.A.,Odintsova T.I.,Egorov T.A.,
  •   Title:Diversity of wheat anti-microbial peptides.
  •   Journal:Peptides, 2005, 26, 2064-2073  [PubMed:16269343]
  •   [2]  Finkina E.I.,Musolyamov A.K.,Slavokhotova A.A.,Vassilevski A.A.,Odintsova T.I.,
  •   Title:A novel antifungal hevein-type peptide from Triticum kiharae seeds with a unique 10-cysteine motif.
  •   Journal:FEBS J., 2009, 276, 4266-4275  [PubMed:19583772]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: