Record in detail


General Info

  • lamp_id:L01A003804
  • Name:putative antimicrobial peptide
  • FullName:putative antimicrobial peptide
  • Source:Opisthacanthus cayaporum
  • Mass:4694.4 Da
  • Sequence Length:43 aa
  • Isoelectric Point:10.8
  • Activity:Antimicrobial
  • Sequence
        GFWSKIKDFAKKAWNSPLANELKSKALNAAKNFVSEKIGATPS
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003804    From 1 To 43 E-value: 6e-19 Score: 84.3
        GFWSKIKDFAKKAWNSPLANELKSKALNAAKNFVSEKIGATPS
  • 2. L12A11085|    From 1 To 39 E-value: 3e-16 Score: 75.5
        SKIKDFAKKAWNSPLANELKSKALNAAKNFVSEKIGATP
  • 3. L12A03192|    From 1 To 43 E-value: 0.00000000007 Score: 57.8
        GIWSWIKKTAKKVWNSDVAKKLKGKALNVAKDFVAEKIGATPA
  • 4. L12A08779|    From 23 To 65 E-value: 0.0000000004 Score: 55.5
        GVWDWLKKTAKNVWNSDIVKQLKGKAINAAKNYVAEKIGATPS
  • 5. L13A011887    From 1 To 43 E-value: 0.0000000004 Score: 55.1
        GVWDWLKKTAKNVWNSDIVKQLKGKAINAAKNYVAEKIGATPS

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: