Record in detail


General Info

  • lamp_id:L01A003807
  • Name:hepcidin antimicrobial peptide
  • FullName:hepcidin antimicrobial peptide
  • Source:Equus caballus (horse)
  • Mass:9170.8 Da
  • Sequence Length:86 aa
  • Isoelectric Point:8.51
  • Activity:Antimicrobial
  • Sequence
        MALNTNIRAACLLLLLLASLTSGSVLPHQTRQLADLQTQDAAGMAGAAAGLMPGLHQLRRRDTHFPICTLCCGCCNKQKCGWCCKT
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003807    From 1 To 86 E-value: 1.4013e-45 Score: 172
        MALNTNIRAACLLLLLLASLTSGSVLPHQTRQLADLQTQDAAGMAGAAAGLMPGLHQLRRRDTHFPICTLCCGCCNKQKCGWCCKT
  • 2. L12A05584|    From 1 To 54 E-value: 5e-27 Score: 111
        LADLQTQDTAGMAGAVAGLMPGLHQLRRRDTHFPICTLCCGCCNKQKCGWCCKT
  • 3. L12A06320|    From 1 To 81 E-value: 5e-26 Score: 107
        MALNAQIRATCILLLLV-SLTSGFVLPPQTRQLADLQTQDTAG---AAAGLTPVLQRLRR-DTHIPICMFCCGCCFKATCGLCCRT
  • 4. L12A09363|    From 1 To 82 E-value: 1e-25 Score: 106
        MSLNTRIQAVCLLLLILASLTSASVLLYQTRQLADLQTQDA---AGATAGLMPGL-QRPRRDTHFPICIFCCGCCYKSKCGICCKT
  • 5. L12A06325|    From 1 To 82 E-value: 5e-25 Score: 104
        MALNTQIRATCLLLLVLLSLTSGSVLPPQTRQLTDLQTKDT---AGAAAGLTPVL-QRRRRDTHFPICIFCCGCCRKGTCGMCCRT

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: