Record in detail


General Info

  • lamp_id:L01A003811
  • Name:amolopin-2k antimicrobial peptide
  • FullName:amolopin-2k antimicrobial peptide
  • Source:Amolops loloensis (rufous-spotted torrent frog)
  • Mass:7191.3 Da
  • Sequence Length:61 aa
  • Isoelectric Point:5.08
  • Activity:Antimicrobial
  • Sequence
        MFTLKKSLLLLFFLATINLSFCEQERNAEEERRDEPDERNAEVEKRFFPIVGKLLFGLLGK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003811    From 1 To 61 E-value: 9e-30 Score: 120
        MFTLKKSLLLLFFLATINLSFCEQERNAEEERRDEPDERNAEVEKRFFPIVGKLLFGLLGK
  • 2. L01A003834    From 1 To 62 E-value: 1e-18 Score: 83.6
        MFTFKKSMLLLFFLGTINLSLCEQERNADEEERRDDPDETNVEVEKRFLPLLAGVVANFLPQ
  • 3. L12A07345|    From 1 To 60 E-value: 7e-18 Score: 80.9
        MFTMKKSMLLLFFLGTINLSLCEQERDAEEERRDDEDKRDVEVEKRFALGAVTKLLPSLL
  • 4. L12A07168|    From 1 To 55 E-value: 1e-17 Score: 80.1
        MFTLKKSMLLLFFLGTINLSLCEQERNADEEERRDNPDEMDVVVEKRFLPLLAGL
  • 5. L12A07365|    From 1 To 53 E-value: 9e-17 Score: 77.4
        MFTTKKPMLLLFFLGTINFSLCEQERDAEEERRDDQDKRDVEVEKRFFLPLLG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: