Record in detail


General Info

  • lamp_id:L01A003814
  • Name:amolopin-2g antimicrobial peptide
  • FullName:amolopin-2g antimicrobial peptide
  • Source:Amolops loloensis (rufous-spotted torrent frog)
  • Mass:7340.4 Da
  • Sequence Length:64 aa
  • Isoelectric Point:5.08
  • Activity:Antimicrobial
  • Sequence
        MFTLKKSLLLLFFLGTINLSLCEQERNAEEERRDEPDERNAEVEKRFFPIVGKLLSGLSGLLGK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003814    From 1 To 64 E-value: 3e-31 Score: 125
        MFTLKKSLLLLFFLGTINLSLCEQERNAEEERRDEPDERNAEVEKRFFPIVGKLLSGLSGLLGK
  • 2. L01A003815    From 1 To 64 E-value: 2e-30 Score: 122
        MFTLKKSLLLLFFLGTINLSLCEQERNAEEERRDEPDERNAEVEKRFFPIVGKLLFGLSGLLGK
  • 3. L01A003834    From 1 To 59 E-value: 5e-20 Score: 88.2
        MFTFKKSMLLLFFLGTINLSLCEQERNADEEERRDDPDETNVEVEKRFLPLLAGVVANF
  • 4. L12A07345|    From 1 To 65 E-value: 3e-19 Score: 85.5
        MFTMKKSMLLLFFLGTINLSLCEQERDAEEERRDDEDKRDVEVEKRFALGAVTKLLPSLLCMISR
  • 5. L12A07168|    From 1 To 57 E-value: 4e-19 Score: 85.1
        MFTLKKSMLLLFFLGTINLSLCEQERNADEEERRDNPDEMDVVVEKRFLP----LLAGLAA

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: