Record in detail


General Info

  • lamp_id:L01A003821
  • Name:amolopin-6b antimicrobial peptide
  • FullName:amolopin-6b antimicrobial peptide
  • Source:Amolops loloensis (rufous-spotted torrent frog)
  • Mass:7590.7 Da
  • Sequence Length:66 aa
  • Isoelectric Point:5.14
  • Activity:Antimicrobial
  • Sequence
        MFTMKKSLLLLFFLGMISLSLCKQERDANEERRDDPDENEENGGEAKVEEIKRAARPPLRCKAAFC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003821    From 1 To 66 E-value: 7e-34 Score: 134
        MFTMKKSLLLLFFLGMISLSLCKQERDANEERRDDPDENEENGGEAKVEEIKRAARPPLRCKAAFC
  • 2. L01A003822    From 1 To 66 E-value: 5e-33 Score: 131
        MFTMKKSLLLLFFLGMISLSLCKQERDANEERRDDPDENEENGGEAKVEEIKRAARPPLGCKAAFC
  • 3. L01A003819    From 1 To 66 E-value: 7e-28 Score: 114
        MFTMKKSLLLLFFLGMISLSLCKQERDANEERRDDPDENEENGGEAKVEEIQRGARPPLRCKAALC
  • 4. L12A07345|    From 1 To 40 E-value: 0.0000000000005 Score: 65.1
        MFTMKKSMLLLFFLGTINLSLCEQERDAEEERRDDEDKRD
  • 5. L12A07339|    From 1 To 44 E-value: 0.000000000002 Score: 62.8
        MFTMKKSLLVLFFLGTISLSLCQEERNA----------DEEDGGEATEEEVKRS

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: