Record in detail


General Info

  • lamp_id:L01A003823
  • Name:amolopin-5a antimicrobial peptide
  • FullName:amolopin-5a antimicrobial peptide
  • Source:Amolops loloensis (rufous-spotted torrent frog)
  • Mass:6730.7 Da
  • Sequence Length:61 aa
  • Isoelectric Point:4.46
  • Activity:Antimicrobial
  • Sequence
        MFTMKKSLLLLFFLGAISLSLCEQERDADEEETEGGAKVETVKRASVPPGFTPFRVAPEIV
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003823    From 1 To 61 E-value: 2e-30 Score: 122
        MFTMKKSLLLLFFLGAISLSLCEQERDADEEETEGGAKVETVKRASVPPGFTPFRVAPEIV
  • 2. L12A07262|    From 1 To 42 E-value: 0.0000000000003 Score: 65.9
        MFTMKKSLLLLFFIGTISLSLCEQERDADEDEREA---LEEVKRG
  • 3. L12A07261|    From 1 To 42 E-value: 0.0000000000003 Score: 65.5
        MFTMKKSLLLLFFIGTISLSLCEQERDADEDE---GEALEEVKRG
  • 4. L12A07338|    From 1 To 54 E-value: 0.0000000000009 Score: 63.9
        MFTMKKSLLVLFFLGTISLSLCQEERDADEEDN---GEVEEVKRGL----FTLIKGAAKLI
  • 5. L12A06968|    From 1 To 42 E-value: 0.000000000002 Score: 63.2
        MFTFKKSLLLLFFIGTISLSLCEQERDADEDE---GEALEEVKRG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: