Record in detail


General Info

  • lamp_id:L01A003824
  • Name:amolopin-p2 antimicrobial peptide
  • FullName:amolopin-p2 antimicrobial peptide
  • Source:Amolops loloensis (rufous-spotted torrent frog)
  • Mass:6837.7 Da
  • Sequence Length:62 aa
  • Isoelectric Point:4.41
  • Activity:Antimicrobial
  • Sequence
        MFTLKKSLLLLFFLGTISLSLCEQERGADEEENGGEVTEQEVKRNVLSSVANGINRALSFFG
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003824    From 1 To 62 E-value: 3e-30 Score: 121
        MFTLKKSLLLLFFLGTISLSLCEQERGADEEENGGEVTEQEVKRNVLSSVANGINRALSFFG
  • 2. L01A003825    From 1 To 62 E-value: 4e-27 Score: 111
        MFPMKKSLLLLFFFGPISLSFCDQERGADEEENGGEVTEQEVKRNILSSIVNGINRALSFFG
  • 3. L12A07248|    From 1 To 51 E-value: 8e-17 Score: 77.4
        MFTMKKSLLLFFFLGTISLSLCEQERGAD-EDDGVEITEEEVKRGLMDTVKN
  • 4. L12A07332|    From 1 To 58 E-value: 1e-16 Score: 77
        MFTMKKSLLLVFFLGTIALSLCEEERGAD-DDNGGEITDEEIKRGILTDTLKGAAKNVA
  • 5. L03A000119    From 1 To 60 E-value: 2e-16 Score: 75.9
        MFTMKKSLLFLFFLGTISLSLCEEERSAD-EDDGGEMTEEEVKRGILDTLKQFAKGVGKDL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: