Record in detail


General Info

  • lamp_id:L01A003833
  • Name:brevinin-1RTa antimicrobial peptide
  • FullName:brevinin-1RTa antimicrobial peptide
  • Source:Amolops ricketti (Chinese sucker frog)
  • Mass:8238.6 Da
  • Sequence Length:71 aa
  • Isoelectric Point:6.55
  • Activity:Antimicrobial
  • Sequence
        MFTFKKSMLLLFFLGTINLSLCEQERNADEEERRDDEDKRDVEVEKRFLGSLLGLVGKIVPTLICKISKKC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003833    From 1 To 71 E-value: 6e-36 Score: 140
        MFTFKKSMLLLFFLGTINLSLCEQERNADEEERRDDEDKRDVEVEKRFLGSLLGLVGKIVPTLICKISKKC
  • 2. L01A003834    From 1 To 71 E-value: 5e-28 Score: 114
        MFTFKKSMLLLFFLGTINLSLCEQERNADEEERRDDPDETNVEVEKRFLPLLAGVVANFLPQIICKIARKC
  • 3. L12A07168|    From 1 To 71 E-value: 2e-26 Score: 109
        MFTLKKSMLLLFFLGTINLSLCEQERNADEEERRDNPDEMDVVVEKRFLPLLAGLAANFLPQIICKIARKC
  • 4. L12A07365|    From 1 To 70 E-value: 1e-25 Score: 107
        MFTTKKPMLLLFFLGTINFSLCEQERDA-EEERRDDQDKRDVEVEKRFFLPLLGAAAQVLPSLICKIFKKC
  • 5. L01A003832    From 1 To 71 E-value: 3e-25 Score: 105
        MFTSKKSMLLLFFLGTINLSLCEQERNADEEERRDDEDKRDVEVEKRFLGSLLGLVGKVVPTLFCKISKKC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: