Record in detail


General Info

  • lamp_id:L01A003849
  • Name:DF123_ARATH
  • FullName:Defensin-like protein 123
  • Source:Arabidopsis thaliana
  • Mass:7157.3 Da
  • Sequence Length:64 aa
  • Isoelectric Point:8.21
  • Activity:Antimicrobial
  • Sequence
        MRPRSRAGDKFMSQGQELCHEYFQLTAPCEKQPCIDMCSSKYKTGKGVCGPAVHQCFCTFSCTV
  • Function:Belongs to the DEFL family.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003849    From 1 To 64 E-value: 5e-34 Score: 134
        MRPRSRAGDKFMSQGQELCHEYFQLTAPCEKQPCIDMCSSKYKTGKGVCGPAVHQCFCTFSCTV
  • 2. L03A000093    From 49 To 80 E-value: 2.1 Score: 23.1
        CRDHCINNDRGNDGYCAGGYPWYRSCFCFFSC
  • 3. L01A002979    From 19 To 50 E-value: 2.2 Score: 22.7
        CRDHCINNDRGNDGYCAGGYPWYRSCFCFFSC
  • 4. L11A010690    From 17 To 47 E-value: 7.6 Score: 21.2
        KPPCRKACISE-KFTDGHCSKILRRCFCTRPC
  • 5. L11A010685    From 6 To 47 E-value: 9 Score: 20.8
        ESHRFKGPCITKPPCRKACISE-KFTDGHCSKILRRCLCTKPC

Structure

  •   Domains
  •   1  Name:SLR1_pollen-bd    Interpro Link:IPR010851
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Kaul S.,Federspiel N.A.,Palm C.J.,Ecker J.R.,Theologis A.,
  •   Title:Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
  •   Journal:Nature, 2000, 408, 816-820  [MEDLINE:21016719]
  •   [2]  VandenBosch K.A.,Paape T.D.,Graham M.A.,Silverstein K.A.T.,
  •   Title:Genome organization of more than 300 defensin-like genes in Arabidopsis.
  •   Journal:Plant Physiol., 2005, 138, 600-610  [PubMed:15955924]
  •   [3]  Graham M.A.,Underwood B.A.,Wu H.C.,Moskal W.A. Jr.,Silverstein K.A.T.,
  •   Title:Small cysteine-rich peptides resembling antimicrobial peptides have been under-predicted in plants.
  •   Journal:Plant J., 2007, 51, 262-280  [PubMed:17565583]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: