Record in detail


General Info

  • lamp_id:L01A003855
  • Name:DF292_ARATH
  • FullName:Defensin-like protein 292
  • Source:Arabidopsis thaliana
  • Mass:7751.8 Da
  • Sequence Length:71 aa
  • Isoelectric Point:6.21
  • Activity:Antimicrobial
  • Sequence
        MLLETDASRNKPSSYIPLCGSDNSCGGLWCPRKGGKYSCISMTCDIQEDCPKLVRCKDSPGPYCMEGFCTC
  • Function:Belongs to the DEFL family.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003855    From 1 To 71 E-value: 3e-37 Score: 145
        MLLETDASRNKPSSYIPLCGSDNSCGGLWCPRKGGKYSCISMTCDIQEDCPKLVRCKDSPGPYCMEGFCTC
  • 2. L12A06676|    From 19 To 59 E-value: 0.12 Score: 26.9
        SVQNCGTGYCENRGGRKTCVCSRCDVGGNFPLEVLLKKGKG
  • 3. L12A10580|    From 33 To 62 E-value: 1.8 Score: 23.1
        FSLILSDCKTNKDCPKLRRANVRCRKS---YCV
  • 4. L13A025115    From 22 To 43 E-value: 7.4 Score: 21.2
        QKLCAGVCRCKISSGLSCPKGF
  • 5. L03A000073    From 16 To 47 E-value: 8 Score: 21.2
        IAMSAMIEAQCIGNGGRCNENVGPPYCCSGFC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Benito M.-I.,Shea T.P.,Rounsley S.D.,Kaul S.,Lin X.,
  •   Title:Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana.
  •   Journal:Nature, 1999, 402, 761-768  [MEDLINE:20083487]
  •   [2]  VandenBosch K.A.,Paape T.D.,Graham M.A.,Silverstein K.A.T.,
  •   Title:Genome organization of more than 300 defensin-like genes in Arabidopsis.
  •   Journal:Plant Physiol., 2005, 138, 600-610  [PubMed:15955924]
  •   [3]  Graham M.A.,Underwood B.A.,Wu H.C.,Moskal W.A. Jr.,Silverstein K.A.T.,
  •   Title:Small cysteine-rich peptides resembling antimicrobial peptides have been under-predicted in plants.
  •   Journal:Plant J., 2007, 51, 262-280  [PubMed:17565583]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: