Record in detail


General Info

  • lamp_id:L01A003857
  • Name:CT115_LACTA
  • FullName:M-zodatoxin-Lt8p
  • Source:Lachesana tarabaevi
  • Mass:8571.4 Da
  • Sequence Length:75 aa
  • Isoelectric Point:11.09
  • Activity:Antimicrobial
  • Sequence
        GFFGNTWKKIKGKADKIMLKKAVKLMVKKEGISKEEAQAKVDAMSKKQIRLYLLKYYGKKSSSKSVRKIVISKSF
  • Function:Insecticidal, cytolytic and antimicrobial peptide. Forms voltage-dependent, ion-permeable channels in membranes. At high concentration causes cell membrane lysis (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003857    From 1 To 75 E-value: 3e-36 Score: 142
        GFFGNTWKKIKGKADKIMLKKAVKLMVKKEGISKEEAQAKVDAMSKKQIRLYLLKYYGKKSSSKSVRKIVISKSF
  • 2. L01A003850    From 1 To 75 E-value: 9e-31 Score: 123
        GFFGNTWKKIKGKADKIMLKKAVKIMVKKEGISKEEAQAKVDAMSKKQIRLYVLKHYGKKSSSKSFRKIVISKSF
  • 3. L01A003434    From 1 To 69 E-value: 1e-29 Score: 119
        GFFGNTWKKIKGKADKIMLKKAVKLMVKKEGISKEEAQAKVDAMSKKQIRLYLLKYYGKKALQKASEKL
  • 4. L01A003387    From 1 To 69 E-value: 3e-29 Score: 118
        GFFGNTWKKIKGKADKIMLKKAVKIMVKKEGISKEEAQAKVDAMSKKQIRLYLLKYYGKKALQKASEKL
  • 5. L01A003432    From 1 To 69 E-value: 5e-29 Score: 117
        GFFGNTWKKIKGKADKIMLKKAVKIMVKKEGITKEEAQAKVDAMSKKQIRLYLLKYYGKKALQKASEKL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Karpunin D.V.,Egorova N.S.,Samsonova O.V.,Kozlov S.A.,Vassilevski A.A.,
  •   Title:Cyto-insectotoxins, a novel class of cytolytic and insecticidal peptides from spider venom.
  •   Journal:Biochem. J., 2008, 411, 687-696  [PubMed:18215128]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: