Record in detail


General Info

  • lamp_id:L01A003870
  • Name:astacidin
  • FullName:astacidin
  • Source:Procambarus clarkii (red swamp crayfish)
  • Mass:4756.6 Da
  • Sequence Length:43 aa
  • Isoelectric Point:11.42
  • Activity:Antimicrobial
  • Sequence
        MRLLHLLLSVALVALMAAVPSQASNGYRPAYRPAYRPSYRPGK
  • Function:

Cross-Linking

  •   Cross-linking

    •     No links found on LAMP database

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003870    From 1 To 43 E-value: 8e-19 Score: 84
        MRLLHLLLSVALVALMAAVPSQASNGYRPAYRPAYRPSYRPGK
  • 2. L12A09122|    From 1 To 41 E-value: 1.8 Score: 23.1
        MRLVVCLVFLASFALVCQGHGYKSGYTRPFSRPPFGGIYRP
  • 3. L12A09038|    From 1 To 21 E-value: 2.2 Score: 22.7
        MRILQLLFEVIVILLLQDVPE
  • 4. L12A09112|    From 1 To 41 E-value: 2.3 Score: 22.7
        MRLVVCLVFLASFALVCQAQGYQGGYTRPFPRPTYGGGYHP
  • 5. L01A002656    From 1 To 23 E-value: 2.8 Score: 22.3
        MRLLWLLVAMVVTVLAAATPTAA

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: