Record in detail


General Info

  • lamp_id:L01A003886
  • Name:antimicrobial peptide Def1-2
  • FullName:antimicrobial peptide Def1-2
  • Source:Nasonia vitripennis (jewel wasp)
  • Mass:3187.7 Da
  • Sequence Length:33 aa
  • Isoelectric Point:8.81
  • Activity:Antimicrobial
  • Sequence
        SFGGKVGHSACAANCLSMGKAGGRCNGGVCQCR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF551    From 7 To 39 E-value: 0.0000000000002 Score: 66.2
        SFGGKVGHSACAANCLSMGKAGGRCNGGVCQCR
  • 2. L01A003886    From 1 To 33 E-value: 0.0000000000004 Score: 65.1
        SFGGKVGHSACAANCLSMGKAGGRCNGGVCQCR
  • 3. L05ADEF550    From 7 To 39 E-value: 0.00000000006 Score: 57.8
        SFGGVVGDSACAANCLSMGKAGGSCNGGICECR
  • 4. L01A003887    From 1 To 33 E-value: 0.0000000001 Score: 56.6
        SFGGVVGDSACAANCLSMGKAGGSCNGGICECR
  • 5. L13A023958    From 8 To 39 E-value: 0.0000000005 Score: 55.1
        FGGVVGDSACAANCLSMGKAGGSCNGGLCDCR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: