Record in detail


General Info

  • lamp_id:L01A003887
  • Name:antimicrobial peptide Def1-1
  • FullName:antimicrobial peptide Def1-1
  • Source:Nasonia vitripennis (jewel wasp)
  • Mass:3082.4 Da
  • Sequence Length:33 aa
  • Isoelectric Point:6.07
  • Activity:Antimicrobial
  • Sequence
        SFGGVVGDSACAANCLSMGKAGGSCNGGICECR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05ADEF550    From 7 To 39 E-value: 0.0000000000003 Score: 65.5
        SFGGVVGDSACAANCLSMGKAGGSCNGGICECR
  • 2. L01A003887    From 1 To 33 E-value: 0.0000000000009 Score: 63.9
        SFGGVVGDSACAANCLSMGKAGGSCNGGICECR
  • 3. L13A023958    From 8 To 39 E-value: 0.000000000004 Score: 61.6
        FGGVVGDSACAANCLSMGKAGGSCNGGLCDCR
  • 4. L02A001752    From 8 To 39 E-value: 0.000000000004 Score: 61.6
        FGGVVGDSACAANCLSMGKAGGSCNGGLCDCR
  • 5. L05ADEF551    From 7 To 39 E-value: 0.00000000009 Score: 57.4
        SFGGKVGHSACAANCLSMGKAGGRCNGGVCQCR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: