Record in detail


General Info

  • lamp_id:L01A003909
  • Name:Sequence 66 from patent US 7582301
  • FullName:Sequence 66 from patent US 7582301
  • Source:Synthetic
  • Mass:4323.8 Da
  • Sequence Length:35 aa
  • Isoelectric Point:4.03
  • Activity:Antiviral
  • Sequence
        EWERKVDFLEENITALLEEAQIQQEKNMYELQKLN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003909    From 1 To 35 E-value: 0.00000000000003 Score: 68.9
        EWERKVDFLEENITALLEEAQIQQEKNMYELQKLN
  • 2. L01A003908    From 1 To 34 E-value: 0.00000000000006 Score: 67.8
        WERKVDFLEENITALLEEAQIQQEKNMYELQKLN
  • 3. L01A003910    From 2 To 35 E-value: 0.0000000000001 Score: 67
        EWERKVDFLEENITALLEEAQIQQEKNMYELQKL
  • 4. L01A003911    From 3 To 35 E-value: 0.0000000000005 Score: 65.1
        EWERKVDFLEENITALLEEAQIQQEKNMYELQK
  • 5. L01A003907    From 1 To 33 E-value: 0.0000000000009 Score: 63.9
        ERKVDFLEENITALLEEAQIQQEKNMYELQKLN

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: