Record in detail


General Info

  • lamp_id:L01A003939
  • Name:Sequence 35 from patent US 7582301
  • FullName:Sequence 35 from patent US 7582301
  • Source:Synthetic
  • Mass:4041.4 Da
  • Sequence Length:35 aa
  • Isoelectric Point:4.83
  • Activity:Antiviral
  • Sequence
        NNSVALDPIDISIELNKAKSDLEESKEWIRRSNQK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A016394    From 5 To 39 E-value: 0.00000000000002 Score: 69.3
        NNSVALDPIDISIELNKAKSDLEESKEWIRRSNQK
  • 2. L01A003939    From 1 To 35 E-value: 0.00000000000003 Score: 68.9
        NNSVALDPIDISIELNKAKSDLEESKEWIRRSNQK
  • 3. L13A027397    From 1 To 34 E-value: 0.00000000000007 Score: 67.4
        NNSVALDPIDISIELNKAKSDLEESKEWIRRSNQ
  • 4. L01A003940    From 2 To 35 E-value: 0.00000000000008 Score: 67.4
        NNSVALDPIDISIELNKAKSDLEESKEWIRRSNQ
  • 5. L01A003938    From 1 To 34 E-value: 0.00000000000009 Score: 67.4
        NSVALDPIDISIELNKAKSDLEESKEWIRRSNQK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: