Record in detail


General Info

  • lamp_id:L01A003954
  • Name:CAMP_HUMAN
  • FullName:Cathelicidin antimicrobial peptide
  • Source:Homo sapiens
  • Mass:4711.5 Da
  • Sequence Length:39 aa
  • Isoelectric Point:11.35
  • Activity:Antibacterial
  • Sequence
        FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • Function:Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A11486|    From 20 To 58 E-value: 6e-17 Score: 78.2
        FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • 2. L01A003954    From 1 To 39 E-value: 8e-17 Score: 77.4
        FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • 3. L11A005007    From 1 To 39 E-value: 3e-16 Score: 75.9
        FALLGDFFRKSKEKIGKEFKRIVQRIKDFFRNLVPRTES
  • 4. L02A000624    From 1 To 38 E-value: 3e-16 Score: 75.5
        ALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • 5. L07APD0026    From 2 To 39 E-value: 7e-16 Score: 74.3
        SLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Structure

  •   Domains
  •   1  Name:Cathelicidin    Interpro Link:IPR001894
  •   2  Name:Cathelicidin_CS    Interpro Link:IPR018216
  •   3  Name:Cathlecidin_C    Interpro Link:IPR022746
  •   Structures

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Boman H.G.,Kogner P.,Odeberg J.,Gunne H.,Agerberth B.,
  •   Title:FALL-39, a putative human peptide antibiotic, is cysteine-free and expressed in bone marrow and testis.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 1995, 92, 195-199  [MEDLINE:95116523]
  •   [2]  Borregaard N.,Johnsen A.H.,Cowland J.B.,
  •   Title:hCAP-18, a cathelin/pro-bactenecin-like protein of human neutrophil specific granules.
  •   Journal:FEBS Lett., 1995, 368, 173-176  [MEDLINE:95339969]
  •   [3]  Zhong J.,Lee J.,Balint R.F.,Hirata M.,Larrick J.W.,
  •   Title:Human CAP18: a novel antimicrobial lipopolysaccharide-binding protein.
  •   Journal:Infect. Immun., 1995, 63, 1291-1297  [MEDLINE:95197251]
  •   [4]  Francke U.,Li X.,Ma S.,Lee J.,Larrick J.W.,
  •   Title:Structural, functional analysis and localization of the human CAP18 gene.
  •   Journal:FEBS Lett., 1996, 398, 74-80  [MEDLINE:97102716]
  •   [5]  Olsson B.,Bergman T.,Odeberg J.,Agerberth B.,Gudmundsson G.H.,
  •   Title:The human gene FALL39 and processing of the cathelin precursor to the antibacterial peptide LL-37 in granulocytes.
  •   Journal:Eur. J. Biochem., 1996, 238, 325-332  [PubMed:8681941]
  •   [6]  Welsch U.,Vogelmeier C.,Weiner D.J.,Lang C.,Bals R.,
  •   Title:Rhesus monkey (Macaca mulatta) mucosal antimicrobial peptides are close homologues of human molecules.
  •   Journal:Clin. Diagn. Lab. Immunol., 2001, 8, 370-375  [MEDLINE:21137962]
  •   [7]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]
  •   [8]  Wang G.,Miller D.W.,Han H.,Li Y.,Li X.,
  •   Title:Solution structures of human LL-37 fragments and NMR-based identification of a minimal membrane-targeting antimicrobial and anticancer region.
  •   Journal:J. Am. Chem. Soc., 2006, 128, 5776-5785  [PubMed:16637646]
  •   [9]  Wang G.
  •   Title:Structures of human host defense cathelicidin LL-37 and its smallest antimicrobial peptide KR-12 in lipid micelles.
  •   Journal:J. Biol. Chem., 2008, 283, 32637-32643  [PubMed:18818205]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: