Record in detail


General Info

  • lamp_id:L01A003962
  • Name:antimicrobial protein CAP18
  • FullName:antimicrobial protein CAP18
  • Source:Oryctolagus cuniculus (rabbit)
  • Mass:4453.4 Da
  • Sequence Length:37 aa
  • Isoelectric Point:12.11
  • Activity:Antibacterial
  • Sequence
        GLRKRLRKFRNKIKEKLKKIGQKIQGFVPKLAPRTDY
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003962    From 1 To 37 E-value: 0.000000000000002 Score: 72.8
        GLRKRLRKFRNKIKEKLKKIGQKIQGFVPKLAPRTDY
  • 2. L01A000997    From 1 To 37 E-value: 0.00000000000002 Score: 69.3
        GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
  • 3. L11A011783    From 1 To 37 E-value: 0.00000000000004 Score: 68.6
        GLRKRLRKFRNKMKEKLKKIGQKIQGLLPKLAPRTDY
  • 4. L11A013094    From 1 To 37 E-value: 0.00000000000006 Score: 67.8
        GLRKRLRKFRNKIKEKLKKIGQKCQGLLPKLAPRTDY
  • 5. L11A013098    From 1 To 37 E-value: 0.00000000000006 Score: 67.8
        GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKCAPRTDY

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: