Record in detail


General Info

  • lamp_id:L01A003966
  • Name:brevinin-2-RA20 antimicrobial peptide
  • FullName:brevinin-2-RA20 antimicrobial peptide
  • Source:Rana andersonii (golden crossband frog)
  • Mass:3394 Da
  • Sequence Length:33 aa
  • Isoelectric Point:8.81
  • Activity:Antimicrobial
  • Sequence
        GLLDTLKNMAINAAKDAGVSVLNTLSCKLSKTC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003966    From 1 To 33 E-value: 0.0000000000006 Score: 64.7
        GLLDTLKNMAINAAKDAGVSVLNTLSCKLSKTC
  • 2. L12A07320|    From 44 To 76 E-value: 0.000000000004 Score: 61.6
        GLLDTIKNMALNAAKSAGVSVLNTLSCKLSKTC
  • 3. L02A001848    From 1 To 33 E-value: 0.00000000001 Score: 60.5
        GLLDTIKNMALNAAKSAGVSVLNTLSCKLSKTC
  • 4. L13A015264    From 1 To 33 E-value: 0.00000000001 Score: 60.1
        GFLDTLKNMAINAAKDAGVSVLNPLSCKLFKTC
  • 5. L01A003973    From 1 To 33 E-value: 0.00000000001 Score: 60.1
        GLLDTLKNMAINAAKGAGVSVLNALSCKLSKTC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: