Record in detail


General Info

  • lamp_id:L01A003983
  • Name:liver-expressed antimicrobial peptide 2A
  • FullName:liver-expressed antimicrobial peptide 2A
  • Source:Oncorhynchus mykiss (rainbow trout)
  • Mass:5999 Da
  • Sequence Length:53 aa
  • Isoelectric Point:9.79
  • Activity:Antimicrobial
  • Sequence
        PEGQRALKRMARMTPLWRTMGTKPYGAYCLNNYECSTGICRGGHCMFSQPIKS
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08930|    From 44 To 96 E-value: 2e-28 Score: 116
        PEGQRALKRMARMTPLWRTMGTKPYGAYCLNNYECSTGICRGGHCMFSQPIKS
  • 2. L01A003983    From 1 To 53 E-value: 8e-28 Score: 114
        PEGQRALKRMARMTPLWRTMGTKPYGAYCLNNYECSTGICRGGHCMFSQPIKS
  • 3. L12A07803|    From 45 To 94 E-value: 4e-22 Score: 95.1
        QRSLRRMARMTPLWRIMGTKPHGAYCQNNYECSTGICRKGHCSFSQPIIS
  • 4. L12A07794|    From 43 To 92 E-value: 3e-21 Score: 92.4
        QRSLKRTARMTPLWRTVGTKPHGAYCQNNYECSTGICRMGHCSYSQPVNS
  • 5. L01A003990    From 29 To 73 E-value: 9e-20 Score: 87
        QRSLRRMARMTPLWRIMGTKPHGAYCQNNYECSTGICRKGHCSFS

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: