Record in detail


General Info

  • lamp_id:L01A003989
  • Name:antimicrobial peptide OGC1
  • FullName:antimicrobial peptide OGC1
  • Source:Rana grahami (Yunnanfu frog)
  • Mass:4966.9 Da
  • Sequence Length:43 aa
  • Isoelectric Point:10.63
  • Activity:Antimicrobial
  • Sequence
        AIGNILKTLGNLAQKILGKQPKMLKLWKWNWKSSDVEYHLAKC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003989    From 1 To 43 E-value: 6e-20 Score: 87.8
        AIGNILKTLGNLAQKILGKQPKMLKLWKWNWKSSDVEYHLAKC
  • 2. L01A003988    From 1 To 19 E-value: 0.00006 Score: 37.7
        AIGNILKTLGNLAQKILGK
  • 3. L12A07086|    From 68 To 86 E-value: 0.0004 Score: 35
        KMLKLNWKSSDVENHLAKC
  • 4. L13A015268    From 23 To 41 E-value: 0.0007 Score: 34.3
        KMLKLNWKSSDVENHLAKC
  • 5. L10A6MBQ00    From 23 To 41 E-value: 0.0007 Score: 34.3
        KMLKLNWKSSDVENHLAKC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: