Record in detail


General Info

  • lamp_id:L01A003995
  • Name:esculentin-2-OG5 antimicrobial peptide
  • FullName:esculentin-2-OG5 antimicrobial peptide
  • Source:Rana grahami (Yunnanfu frog)
  • Mass:3849.6 Da
  • Sequence Length:37 aa
  • Isoelectric Point:10.23
  • Activity:Antimicrobial
  • Sequence
        GLFTLIKGAAKLIGRTVAKEAGKTGLELMACKITNQC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003995    From 1 To 37 E-value: 0.000000000000001 Score: 73.2
        GLFTLIKGAAKLIGRTVAKEAGKTGLELMACKITNQC
  • 2. L12A07355|    From 42 To 78 E-value: 0.000000000000002 Score: 72.8
        GLFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQC
  • 3. L12A07337|    From 42 To 78 E-value: 0.000000000000002 Score: 72.8
        GLFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQC
  • 4. L12A00911|    From 21 To 57 E-value: 0.000000000000002 Score: 72.4
        GLFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQC
  • 5. L01A003162    From 1 To 37 E-value: 0.000000000000004 Score: 71.6
        GLFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: