Record in detail


General Info

  • lamp_id:L01A004012
  • Name:antimicrobial peptide [Aspergillus clavatus]
  • FullName:antimicrobial peptide [Aspergillus clavatus]
  • Source:Aspergillus clavatus
  • Mass:5603.5 Da
  • Sequence Length:49 aa
  • Isoelectric Point:9.08
  • Activity:Antifungal
  • Sequence
        TYDGKCYKKDNICKYKAQSGKTAICKCYVKVCPRDGAKCEFDSYKGKCY
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L13A010182    From 2 To 50 E-value: 2e-22 Score: 96.3
        TYDGKCYKKDNICKYKAQSGKTAICKCYVKVCPRDGAKCEFDSYKGKCY
  • 2. L01A004012    From 1 To 49 E-value: 2e-22 Score: 95.9
        TYDGKCYKKDNICKYKAQSGKTAICKCYVKVCPRDGAKCEFDSYKGKCY
  • 3. L02A001559    From 2 To 50 E-value: 2e-22 Score: 95.9
        TYDGKCYKKDNICKYKAQSGKTAICKCYVKVCPRDGAKCEFDSYKGKCY
  • 4. L03A000149    From 45 To 93 E-value: 5e-22 Score: 94.7
        TYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCY
  • 5. L13A028663    From 2 To 50 E-value: 3e-21 Score: 92
        TYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCY

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: