Record in detail


General Info

  • lamp_id:L01A004014
  • Name:ranatuerin-2C antimicrobial peptide
  • FullName:ranatuerin-2C antimicrobial peptide
  • Source:Rana catesbeiana (bullfrog)
  • Mass:4938.6 Da
  • Sequence Length:44 aa
  • Isoelectric Point:4.19
  • Activity:Antimicrobial
  • Sequence
        FTVKKSLLLLFFLGTITLSFCEQERGADEDNGGEMTEEEVKRGV
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A004014    From 1 To 44 E-value: 6e-20 Score: 87.8
        FTVKKSLLLLFFLGTITLSFCEQERGADEDNGGEMTEEEVKRGV
  • 2. L03A000119    From 2 To 45 E-value: 1e-16 Score: 76.6
        FTMKKSLLFLFFLGTISLSLCEEERSADEDDGGEMTEEEVKRGI
  • 3. L12A07332|    From 2 To 45 E-value: 2e-16 Score: 76.3
        FTMKKSLLLVFFLGTIALSLCEEERGADDDNGGEITDEEIKRGI
  • 4. L12A07013|    From 2 To 45 E-value: 2e-16 Score: 76.3
        FTLKKSLLLFFFLGTISLSLCEQERGADEDDGVEMTEEEVKRGL
  • 5. L12A07248|    From 2 To 45 E-value: 5e-16 Score: 74.7
        FTMKKSLLLFFFLGTISLSLCEQERGADEDDGVEITEEEVKRGL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: