Record in detail


General Info

  • lamp_id:L01A004015
  • Name:ranatuerin-1Cb antimicrobial peptide
  • FullName:ranatuerin-1Cb antimicrobial peptide
  • Source:Rana catesbeiana (bullfrog)
  • Mass:4161.7 Da
  • Sequence Length:37 aa
  • Isoelectric Point:4.13
  • Activity:Antimicrobial
  • Sequence
        FTMKKSLLPLFFLGTITLSLCEQERGADEEEGNGEKE
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A004015    From 1 To 37 E-value: 5e-16 Score: 74.7
        FTMKKSLLPLFFLGTITLSLCEQERGADEEEGNGEKE
  • 2. L12A07243|    From 2 To 36 E-value: 0.00000000003 Score: 58.9
        FTMKKSLLFLFFLGTISLSLCEQERGADEDDGGEE
  • 3. L12A07323|    From 2 To 38 E-value: 0.00000000003 Score: 58.9
        FTMKKSLLLLFFLGTITLSLCEQERGADEEEGNGEKE
  • 4. L12A07322|    From 2 To 38 E-value: 0.00000000003 Score: 58.5
        FTMKKSLLLLFFLGTITLSLCEQERGADEEEGNGEKE
  • 5. L12A07247|    From 2 To 36 E-value: 0.00000000005 Score: 58.2
        FTMKKSLLLFFFLGTISLSLCEQERGADEDDGGEE

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: