Record in detail


General Info

  • lamp_id:L01A004016
  • Name:ranatuerin-1Ca antimicrobial peptide
  • FullName:ranatuerin-1Ca antimicrobial peptide
  • Source:Rana catesbeiana (bullfrog)
  • Mass:4219.7 Da
  • Sequence Length:37 aa
  • Isoelectric Point:4.13
  • Activity:Antimicrobial
  • Sequence
        FPLKKSLLLLFFFGTIPLSFCEQERGADEEEGNGEKE
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A004016    From 1 To 37 E-value: 9e-16 Score: 73.9
        FPLKKSLLLLFFFGTIPLSFCEQERGADEEEGNGEKE
  • 2. L01A004015    From 1 To 37 E-value: 0.000000000003 Score: 62
        FTMKKSLLPLFFLGTITLSLCEQERGADEEEGNGEKE
  • 3. L01A003825    From 2 To 36 E-value: 0.000000000009 Score: 60.5
        FPMKKSLLLLFFFGPISLSFCDQERGADEEENGGE
  • 4. L12A06957|    From 2 To 33 E-value: 0.0000000001 Score: 57
        FPMKKSLLVLFFFGTISLSFCQEERNADEEDG
  • 5. L12A09954|    From 1 To 32 E-value: 0.0000000002 Score: 55.8
        PMKKSLLLLFFFGTISLSLCQQERDADEEEGS

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: