Record in detail


General Info

  • lamp_id:L01A004021
  • Name:Gaegurin-6-RN antimicrobial peptide
  • FullName:Gaegurin-6-RN antimicrobial peptide
  • Source:Rana nigrovittata (black-striped frog)
  • Mass:5321 Da
  • Sequence Length:45 aa
  • Isoelectric Point:4.21
  • Activity:Antimicrobial
  • Sequence
        FTMKKSLLLIFFLGTINLSLCEEERNAEEEKRDGDDEMDVEVQKR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07254|    From 2 To 46 E-value: 6e-21 Score: 91.3
        FTMKKSLLLIFFLGTINLSLCEEERNAEEEKRDGDDEMDVEVQKR
  • 2. L12A07256|    From 2 To 46 E-value: 6e-21 Score: 90.9
        FTMKKSLLLIFFLGTINLSLCEEERNAEEEKRDGDDEMDVEVQKR
  • 3. L12A07253|    From 2 To 46 E-value: 6e-21 Score: 90.9
        FTMKKSLLLIFFLGTINLSLCEEERNAEEEKRDGDDEMDVEVQKR
  • 4. L12A07257|    From 2 To 46 E-value: 6e-21 Score: 90.9
        FTMKKSLLLIFFLGTINLSLCEEERNAEEEKRDGDDEMDVEVQKR
  • 5. L12A07255|    From 2 To 46 E-value: 7e-21 Score: 90.9
        FTMKKSLLLIFFLGTINLSLCEEERNAEEEKRDGDDEMDVEVQKR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: