Record in detail


General Info

  • lamp_id:L01A004022
  • Name:Gaegurin-6-RN antimicrobial peptide
  • FullName:Gaegurin-6-RN antimicrobial peptide
  • Source:Rana nigrovittata (black-striped frog)
  • Mass:5133.8 Da
  • Sequence Length:44 aa
  • Isoelectric Point:4.3
  • Activity:Antimicrobial
  • Sequence
        FTMKKSLLLLFFLGTINLSLCEKERNAEEEKRDGDDETDVEVQK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A004022    From 1 To 44 E-value: 6e-20 Score: 87.8
        FTMKKSLLLLFFLGTINLSLCEKERNAEEEKRDGDDETDVEVQK
  • 2. L12A11512|    From 1 To 43 E-value: 1e-16 Score: 77
        TMKKSLLLIFFLGTINLSLCQEERNAEEEKRDGDDEMDAEVEK
  • 3. L12A07345|    From 2 To 45 E-value: 0.000000000000002 Score: 73.2
        FTMKKSMLLLFFLGTINLSLCEQERDAEEERRDDEDKRDVEVEK
  • 4. L12A07221|    From 2 To 45 E-value: 0.000000000000005 Score: 71.6
        FTMKKPMLLLFFLGTINLSLCEQERDAEEERRDDEDKRDVEVEK
  • 5. L01A003834    From 2 To 46 E-value: 0.00000000000001 Score: 70.1
        FTFKKSMLLLFFLGTINLSLCEQERNADEEERRDDPDETNVEVEK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: