Record in detail
General Info
- lamp_id:L02A000045
- Name:DFB10_BOVIN
- FullName:Beta-defensin 10
- Source:Bos taurus
- Mass:4526.4 Da
- Sequence Length:40 aa
- Isoelectric Point:10.46
- Activity:Antibacterial,Antifungal,Antiviral,
- Sequence
QGVRSYLSCWGNRGICLLNRCPGRMRQIGTCLAPRVKCCR - Function:Has bactericidal activity. Active against E.coli ML35 and S.aureus 502A.
Cross-Linking
- Cross-linking
- 1 Database:APD 45
- 2 Database:CAMP CAMPSQ2715
- 3 Database:dbAMP dbAMP_10099
- 4 Database:DRAMP DRAMP02867
- 5 Database:SATPdb satpdb26601
- 6 Database:Uniprot P46168
- 7 Database:AMD BD10_BOVIN
- 8 Database:DEF DEF79
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A09087| From 23 To 62 E-value: 9e-19 Score: 84
QGVRSYLSCWGNRGICLLNRCPGRMRQIGTCLAPRVKCCR - 2. L12A09092| From 23 To 62 E-value: 1e-18 Score: 83.6
QGVRSYLSCWGNRGICLLNRCPGRMRQIGTCLAPRVKCCR - 3. L12A02365| From 3 To 42 E-value: 3e-18 Score: 82
QGVRSYLSCWGNRGICLLNRCPGRMRQIGTCLAPRVKCCR - 4. L02A000045 From 1 To 40 E-value: 5e-18 Score: 81.6
QGVRSYLSCWGNRGICLLNRCPGRMRQIGTCLAPRVKCCR - 5. L01A000369 From 1 To 40 E-value: 8e-18 Score: 80.9
EGVRSYLSCWGNRGICLLNRCPGRMRQIGTCLAPRVKCCR
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Novotny M.J.,McGuire P.A.,Morris W.L.,Tang Y.-Q.,Selsted M.E.,
- Title:Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils.
- Journal:J. Biol. Chem., 1993, 268, 6641-6648 [MEDLINE:93203264]
- [2] Kalm E.,Schroder J.M.,Paul S.,Exner K.,Roosen S.,
- Title:Bovine beta-defensins: identification and characterization of novel bovine beta-defensin genes and their expression in mammary gland tissue.
- Journal:Mamm. Genome, 2004, 15, 834-842 [PubMed:15520886]
Comments
- Comments
No comments found on LAMP database