Record in detail


General Info

  • lamp_id:L02A000226
  • Name:DEFI_APIME
  • FullName:Defensin-1
  • Source:Apis mellifera
  • Mass:5525.3 Da
  • Sequence Length:51 aa
  • Isoelectric Point:8.39
  • Activity:Antibacterial,Antifungal,Antiviral,,,Insecticidal
  • Sequence
        VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKVGCICRKTSFKDLWDKRF
  • Function:Found in royal jelly and in hemolymph, potent antibacterial protein against Gram-positive bacteria at low concentration.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A000226    From 1 To 51 E-value: 5e-25 Score: 104
        VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKVGCICRKTSFKDLWDKRF
  • 2. L01A000214    From 1 To 51 E-value: 2e-24 Score: 102
        VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKVGCICRKTSFKDLWDKYF
  • 3. L13A022983    From 1 To 50 E-value: 2e-24 Score: 102
        VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKVGCICRKTSFKDLWDKR
  • 4. L12A07935|    From 44 To 94 E-value: 4e-24 Score: 101
        VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKGVCICRKTSFKDLWDKRF
  • 5. L12A11927|    From 1 To 51 E-value: 3e-23 Score: 99
        VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKGVCICRKTSFKDLWDKRF

Structure

  •   Domains
  •   1  Name:Defensin_insect    Interpro Link:IPR017982
  •   2  Name:Defensin_invertebrate/fungal    Interpro Link:IPR001542
  •   3  Name:Knot1    Interpro Link:IPR003614
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Kawashima T.,Yaeshima T.,Fujiwara M.,Imai J.,Fujiwara S.,
  •   Title:A potent antibacterial protein in royal jelly. Purification and determination of the primary structure of royalisin.
  •   Journal:J. Biol. Chem., 1990, 265, 11333-11337  [MEDLINE:90293084]
  •   [2]  Tempst P.,Casteels P.,Capaci T.,Zhang W.,Casteels-Josson K.,
  •   Title:Acute transcriptional response of the honeybee peptide-antibiotics gene repertoire and required post-translational conversion of the precursor structures.
  •   Journal:J. Biol. Chem., 1994, 269, 28569-28575  [MEDLINE:95050655]
  •   [3]  Simuth J.,Kopernicky J.,Bachanova K.,Albert S.,Klaudiny J.,
  •   Title:Two structurally different defensin genes, one of them encoding a novel defensin isoform, are expressed in honeybee Apis mellifera.
  •   Journal:Insect Biochem. Mol. Biol., 2005, 35, 11-22  [PubMed:15607651]
  •   [4]  Tingek S.,Rueppell O.,Hasselmann M.,Evans J.D.,Viljakainen L.,
  •   Title:Rapid evolution of immune proteins in social insects.
  •   Journal:Mol. Biol. Evol., 2009, 26, 1791-1801  [PubMed:19387012]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: