Record in detail


General Info

  • lamp_id:L02A000237
  • Name:THN_PHOTO
  • FullName:Phoratoxin
  • Source:Phoradendron tomentosum
  • Mass:4880.6 Da
  • Sequence Length:46 aa
  • Isoelectric Point:9.2
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        KSCCPTTTARNIYNTCRFGGGSRPVCAKLSGCKIISGTKCDSGWNH
  • Function:Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A000237    From 1 To 46 E-value: 4e-22 Score: 95.1
        KSCCPTTTARNIYNTCRFGGGSRPVCAKLSGCKIISGTKCDSGWNH
  • 2. L01A003071    From 1 To 46 E-value: 6e-18 Score: 81.3
        KSCCPSTTARNIYNTCRLTGASRSVCASLSGCKIISGSTCDSGWNH
  • 3. L06AT00070    From 1 To 46 E-value: 2e-17 Score: 79.7
        KSCCPSTTARNIYNTCRLTGTSRPTCASLSGCKIISGSTCBSGWBH
  • 4. L02A001281    From 1 To 44 E-value: 0.00000000000001 Score: 70.1
        KSCCPNTTGRNIYNTCRFGGGSRQVCASLSGCKIISASTCPSDY
  • 5. L02A001278    From 1 To 44 E-value: 0.00000000000001 Score: 70.1
        KSCCPNTTGRNIYNTCRFGGGSREVCARISGCKIISASTCPSDY

Structure

  •   Domains
  •   1  Name:Thionin    Interpro Link:IPR001010
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Samuelsson G.
  •   Title:Mistletoe toxins.
  •   Journal:Syst. Zool., 1973, 22, 566-569  [:]
  •   [2]  Samuelsson G.,Mellstrand S.T.,
  •   Title:Phoratoxin, a toxic protein from the mistletoe Phoradendron tomentosum subsp. macrophyllum (Loranthaceae). The amino acid sequence.
  •   Journal:Acta Pharm. Suec., 1974, 11, 347-360  [MEDLINE:75013484]
  •   [3]  Samuelsson G.,Mellstrand S.T.,
  •   Title:Phoratoxin, a toxic protein from the mistletoe Phoradendron tomentosum subsp. macrophyllum (Loranthaceae). The disulphide bonds.
  •   Journal:Acta Pharm. Suec., 1974, 11, 367-374  [MEDLINE:75013480]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: