Record in detail


General Info

  • lamp_id:L02A000266
  • Name:AMP1_MELGA
  • FullName:Antimicrobial peptide THP1
  • Source:Meleagris gallopavo
  • Mass:4425.3 Da
  • Sequence Length:40 aa
  • Isoelectric Point:9.79
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GKREKCLRRNGFCAFLKCPTLSVISGTCSRFQVCCKTLLG
  • Function:Bactericidal activity; inhibits S.aureus and E.coli.

Cross-Linking

  •   Cross-linking
  •   1  Database:APD  266
  •   2  Database:dbAMP  dbAMP_03231
  •   3  Database:SATPdb  satpdb18860
  •   4  Database:Uniprot  P80391

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000257    From 26 To 65 E-value: 3e-18 Score: 82.4
        GKREKCLRRNGFCAFLKCPTLSVISGTCSRFQVCCKTLLG
  • 2. L02A000266    From 1 To 40 E-value: 1e-17 Score: 80.5
        GKREKCLRRNGFCAFLKCPTLSVISGTCSRFQVCCKTLLG
  • 3. L01A000580    From 1 To 35 E-value: 0.000000000000004 Score: 71.6
        GKREKCLRRNGFCAFLKCPTLSVISGTCSRFQVCC
  • 4. L12A09054|    From 26 To 65 E-value: 0.00000000001 Score: 60.1
        GRKSDCFRKNGFCAFLKCPYLTLISGKCSRFHLCCKRIWG
  • 5. L03A000259    From 26 To 65 E-value: 0.00000000005 Score: 58.2
        GRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIWG

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Harmon B.G.,Wunderlich J.,Beach G.G.,Evans E.W.,
  •   Title:Isolation of antimicrobial peptides from avian heterophils.
  •   Journal:J. Leukoc. Biol., 1994, 56, 661-665  [MEDLINE:95053386]
  •   [2]  Jackwood M.W.,Harmon B.G.,Brockus C.W.,
  •   Title:Characterization of beta-defensin prepropeptide mRNA from chicken and turkey bone marrow.
  •   Journal:Anim. Genet., 1998, 29, 283-289  [MEDLINE:98418188]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: