Record in detail


General Info

  • lamp_id:L02A000267
  • Name:AMP2_MELGA
  • FullName:Antimicrobial peptide THP2
  • Source:Meleagris gallopavo
  • Mass:4134.9 Da
  • Sequence Length:36 aa
  • Isoelectric Point:8.9
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        LFCKRGTCHFGRCPSHLIKVGSCFGFRSCCKWPWDA
  • Function:Antibacterial activity against the Gram-positive bacterium Staphylococcus aureus. Lacks antibacterial activity against the Gram-negative bacterium E.coli K-12.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000255    From 29 To 64 E-value: 2e-17 Score: 79.3
        LFCKRGTCHFGRCPSHLIKVGSCFGFRSCCKWPWDA
  • 2. L12A09039|    From 29 To 64 E-value: 1e-16 Score: 76.6
        LFCKRGSCHFGRCPSHLIKVGSCFGFRSCCKWPWDA
  • 3. L02A000267    From 1 To 36 E-value: 2e-16 Score: 76.3
        LFCKRGTCHFGRCPSHLIKVGSCFGFRSCCKWPWDA
  • 4. L05ADEF300    From 29 To 64 E-value: 0.00000000000002 Score: 69.7
        LFCKGGSCHFGGCPSHLIKVGSCFGFRSCCKWPWNA
  • 5. L12A09042|    From 29 To 64 E-value: 0.00000000000002 Score: 69.7
        LFCKGGSCHFGGCPSHLIKVGSCFGFRSCCKWPWNA

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Harmon B.G.,Wunderlich J.,Beach G.G.,Evans E.W.,
  •   Title:Isolation of antimicrobial peptides from avian heterophils.
  •   Journal:J. Leukoc. Biol., 1994, 56, 661-665  [MEDLINE:95053386]
  •   [2]  Jackwood M.W.,Harmon B.G.,Brockus C.W.,
  •   Title:Characterization of beta-defensin prepropeptide mRNA from chicken and turkey bone marrow.
  •   Journal:Anim. Genet., 1998, 29, 283-289  [MEDLINE:98418188]
  •   [3]  Lay J.O. Jr.,Liyanage R.,Rath N.C.,Kannan L.,
  •   Title:Direct screening identifies mature beta-defensin 2 in avian heterophils.
  •   Journal:Poult. Sci., 2009, 88, 372-379  [PubMed:19151352]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: