Record in detail


General Info

  • lamp_id:L02A000268
  • Name:sBD-1
  • FullName:sBD-1 (sheep beta defensin 1; animals)
  • Source:Sheep, Ovis arues
  • Mass:4363.2 Da
  • Sequence Length:38 aa
  • Isoelectric Point:11.51
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        NRLSCHRNKGVCVPSRCPRHMRQIGTCRGPPVKCCRKK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000266    From 27 To 64 E-value: 3e-17 Score: 79
        NRLSCHRNKGVCVPSRCPRHMRQIGTCRGPPVKCCRKK
  • 2. L01A003032    From 5 To 42 E-value: 1e-16 Score: 76.6
        NRLSCHRNKGVCVPSRCPRHMRQIGTCRGPPVKCCRKK
  • 3. L02A000268    From 1 To 38 E-value: 2e-16 Score: 76.6
        NRLSCHRNKGVCVPSRCPRHMRQIGTCRGPPVKCCRKK
  • 4. L03A000260    From 27 To 64 E-value: 0.0000000000004 Score: 65.5
        NHRSCYRNKGVCAPARCPRNMRQIGTCHGPPVKCCRKK
  • 5. L12A04055|    From 10 To 47 E-value: 0.0000000000004 Score: 65.1
        NHRSCYRNKGVCAPARCPRNMRQIGTCHGPPVKCCRKK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: