Record in detail


General Info

  • lamp_id:L02A000271
  • Name:CTHL2_CAPHI
  • FullName:Cathelicidin-2
  • Source:Capra hircus
  • Mass:5162.1 Da
  • Sequence Length:43 aa
  • Isoelectric Point:13.45
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        RFRPPIRRPPIRPPFNPPFRPPVRPPFRPPFRPPFRPPIGPFP
  • Function:Binds to the lipid A moiety of bacterial lipopolysaccharides (LPS), a glycolipid present in the outer membrane of all Gram-negative bacteria. Shows a potent antimicrobial activity against the Gram-negative bacteria E.coli, S.typhimurium and P.aeruginosa. Less active against the Gram-positive bacteria S.aureus, L.monocytogenes and B.subtilis.

Cross-Linking

  •   Cross-linking
  •   1  Database:APD  271
  •   2  Database:DBAASP  1263
  •   3  Database:dbAMP  dbAMP_10413
  •   4  Database:DRAMP  DRAMP03679
  •   5  Database:SATPdb  satpdb28396
  •   6  Database:Uniprot  P82018

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A000631    From 1 To 43 E-value: 0.0000000000005 Score: 64.7
        RFRPPIRRPPIRPPFNPPFRPPVRPPFRPPFRPPFRPPIGPFP
  • 2. L02A000271    From 1 To 43 E-value: 0.0000000000005 Score: 64.7
        RFRPPIRRPPIRPPFNPPFRPPVRPPFRPPFRPPFRPPIGPFP
  • 3. L12A09969|    From 1 To 35 E-value: 0.38 Score: 25.4
        PPIQNPSMAPPTQNPYGQPMTPPTQNPYGQPMAPP
  • 4. L12A09969|    From 5 To 29 E-value: 9.8 Score: 20.8
        NPSMAPPTQNPYGQPMTPPTQNPYG
  • 5. L12A09122|    From 22 To 58 E-value: 2.1 Score: 22.7
        YKSGYTRPFSRPPFGGIYR-PVRPVCNACYRLSYSDAL

Structure

  •   Domains
  •   1  Name:Cathelicidin    Interpro Link:IPR001894
  •   2  Name:Cathelicidin_CS    Interpro Link:IPR018216
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Kokryakov V.N.,Nguyen T.,Zhao C.,Brogden K.A.,Shamova O.,
  •   Title:Purification and properties of proline-rich antimicrobial peptides from sheep and goat leukocytes.
  •   Journal:Infect. Immun., 1999, 67, 4106-4111  [MEDLINE:99346202]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: